DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3556 and tcn2

DIOPT Version :9

Sequence 1:NP_001245529.1 Gene:CG3556 / 31380 FlyBaseID:FBgn0029708 Length:595 Species:Drosophila melanogaster
Sequence 2:NP_001116703.1 Gene:tcn2 / 407646 ZFINID:ZDB-GENE-030131-4648 Length:423 Species:Danio rerio


Alignment Length:426 Identity:99/426 - (23%)
Similarity:158/426 - (37%) Gaps:106/426 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 ASDYGWGNDTHVVILAKELSGGRD-----PNDSVDGHVQVIQELEDTLSVKEMEIEILAMLDR-- 237
            |||:    :|.:..|.|:|....|     ||.||  |:.:....:..|   :.|.:.|..|.:  
Zfish    20 ASDH----ETLLQSLNKQLLRSVDTQDNLPNPSV--HIALRLSTQHNL---DKENQYLNRLKKEF 75

  Fly   238 HHTLPKPLD-----LDKLARYVLALGSLCKDPKHFHGHDLVATLQHHEPAQDIEFALTTLSACSS 297
            |..:.|.|.     :.:||.|:|||.|.|        |||...|.|:|..   ||.||       
Zfish    76 HEDIEKSLRNGELVVGRLALYILALRSSC--------HDLSLHLNHNEKN---EFLLT------- 122

  Fly   298 AAHVRKRQIRRLLDIA------SGVTDQSVDAIAMVILALRCIVTDHRHRHLQHFVRRPARGLAT 356
              |::|.......:||      :.....|:..:|:.:..:|  |:.|....|.|.|...      
Zfish   123 --HLKKEMEEEKQNIAFSHRPKTNYYQYSLGILALCVSGVR--VSTHVSHKLIHAVEHG------ 177

  Fly   357 LQDQRGSFGSLRSTALAMQALQ-----------DLEYDPAGHWNRTAASRYILSRQRADGGWSEE 410
             |.:.|....:.|.|:|..|||           :.|.|.|    .....:.::..:||||....|
Zfish   178 -QIKHGESLCIDSHAMAGMALQCLKNEGISVKDEAELDKA----LATIKQKLVDSKRADGHMGNE 237

  Fly   411 PLQDGQEPDIGVGLTADIILALG--WKGLG-AVRALQCDHVIRESS--DPTENGE--PKLAVPFG 468
                     ...||....:||:|  .:..| |:.||:.|  ||:.:  :|....:  |.|.....
Zfish   238 ---------FSTGLAVQALLAMGVEMEECGTAIEALRGD--IRKGTYHNPMAASQVLPALYQQSY 291

  Fly   469 LSSSAEESDAKNISYTYTLWVGSNVTESFSLSLVS-----------------PKNTSFFKAMTQA 516
            |...::|..:::.:.|..:...|.|..|.....|.                 ||.:|.|:|:...
Zfish   292 LHLKSKECRSEDDTLTADVESASEVLPSLGQVAVQVEVIKSNGEASVFPINVPKGSSLFEALNLL 356

  Fly   517 AEMDPRFIFEAREWPNGHYVHTLYGKKEEPRGYHYW 552
            .:....|.|:..:...|.::..|..::.......||
Zfish   357 QDKQTGFTFKTEDSLWGAFLSVLNDEQARQTDRRYW 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3556NP_001245529.1 ISOPREN_C2_like 165..411 CDD:298658 65/259 (25%)
tcn2NP_001116703.1 Cobalamin_bind 17..318 CDD:279466 86/350 (25%)
DUF4430 347..421 CDD:291166 9/46 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594432
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1233171at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10559
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.