DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3556 and Cblif

DIOPT Version :9

Sequence 1:NP_001245529.1 Gene:CG3556 / 31380 FlyBaseID:FBgn0029708 Length:595 Species:Drosophila melanogaster
Sequence 2:NP_058858.1 Gene:Cblif / 29319 RGDID:62084 Length:421 Species:Rattus norvegicus


Alignment Length:443 Identity:98/443 - (22%)
Similarity:160/443 - (36%) Gaps:108/443 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 SGTPPEHQTIGQAPPTKGEQEAILRALDWLKEKRASDYGWGNDTHVVILAKELSGGRDPNDSVDG 210
            :||....|.....||   :|:..:..|..|.|...::....|.:  :::|..|:           
  Rat    20 AGTSTRAQRSCSVPP---DQQPWVNGLQLLMENSVTESDLPNPS--ILIAMNLA----------- 68

  Fly   211 HVQVIQELEDTLSVKEMEIEILAMLDRHHTLPKPLDLDKLARYVLALGSLCKDPKHFHGHDLVAT 275
                        |...:|.:.|.......:....|...:||..::||.|.|:||     ...|:.
  Rat    69 ------------STYNLEAQKLLTYQLMASDSADLTNGQLALTIMALTSSCRDP-----GSKVSI 116

  Fly   276 LQHHEP--------AQDIEF---ALTTLSACSSAAH----VRKRQIRRLLDIASGVTDQSVDAIA 325
            ||.:..        |:...|   ||..|:.|...:.    :..|..:.|:..:|..   |||..|
  Rat   117 LQKNMESWTPSNLGAESSSFYGPALAILALCQKNSEATLPIAVRFAKTLMMESSPF---SVDTGA 178

  Fly   326 MVILALRC------IVTDHRHRHLQHFVRRPARGLATLQDQ-------RGSFGSLRSTALAMQAL 377
            :..|||.|      :.:...:|.|.      .:.|..:.|.       .|..|.:.||.||||||
  Rat   179 VATLALTCMYNRIPVGSQENYRDLF------GQALKVIVDNISLRIKADGIIGDIYSTGLAMQAL 237

  Fly   378 QDLEYDPAGHWNRTAASRYILSRQRADGGWSEEPLQDGQEPDIGVGLTADIILALGWKGLGAVRA 442
            ......|...|: ...:.|.:.::...|.: :.|:.           .|.|:.:|..|....|..
  Rat   238 SVTPEQPTKEWD-CEKTMYTILKEIKQGKF-QNPMS-----------IAQILPSLKGKTYLDVPQ 289

  Fly   443 LQC--DHVIRESSDPTENGEPKLAVPFGLSSSAEESDAKNISYTYTLWVGSN----VTESFSLSL 501
            :.|  ||.:    .||....| ..||..:|         ||:..||:   :|    |...|::::
  Rat   290 VTCGPDHEV----PPTLTDYP-TPVPTSIS---------NITVIYTI---NNQLRGVDLLFNVTI 337

  Fly   502 -VSPKNTSFFKAMTQAAE-MDPRFIFEAREWPNGHYVHTLYGKKEEPRGYHYW 552
             ||.|:.|...|:.:.|: .:..|.||......|..|.::....|..:...||
  Rat   338 EVSVKSGSVLLAVLEEAQRRNHMFKFETTMTSWGLIVSSINNIAENVKHKTYW 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3556NP_001245529.1 ISOPREN_C2_like 165..411 CDD:298658 57/273 (21%)
CblifNP_058858.1 Cobalamin_bind 29..310 CDD:279466 71/340 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352497
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1233171at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10559
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.