DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bi and Tbx4

DIOPT Version :9

Sequence 1:NP_001259238.1 Gene:bi / 31379 FlyBaseID:FBgn0000179 Length:1023 Species:Drosophila melanogaster
Sequence 2:NP_035666.2 Gene:Tbx4 / 21387 MGIID:102556 Length:552 Species:Mus musculus


Alignment Length:399 Identity:158/399 - (39%)
Similarity:207/399 - (51%) Gaps:83/399 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 QQQQQHPAPPPPPYFPAAALAALAGSPAGPHPGLYPGGGLRFPPHHPGAHPHAHHLGSAYTTAED 296
            :.::...||.|.....:......|..||...||| .|..|..||.. ||               |
Mouse     9 ESEEAFRAPGPALGEASNTSTTNAPEPALATPGL-SGAALSSPPGQ-GA---------------D 56

  Fly   297 VVLASAVAHQLHPAMRPLRALQPEDDGVVDDPKVTLEGKDLWEKFHKLGTEMVITKSGRQMFPQM 361
            |..|:|.|                .:..:::.||.|..|:||:|||:.||||:|||:||:|||..
Mouse    57 VAAAAAAA----------------AEQTIENIKVGLHEKELWKKFHEAGTEMIITKAGRRMFPSY 105

  Fly   362 KFRVSGLDAKAKYILLLDIVAADDYRYKFHNSRWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKV 426
            |.:|:|::.|.|||||:|||.|||:||||.:::|||||||:|.||.|:|:|||||.||..||:::
Mouse   106 KVKVTGMNPKTKYILLIDIVPADDHRYKFCDNKWMVAGKAEPAMPGRLYVHPDSPATGAHWMRQL 170

  Fly   427 VSFHKLKLTNNISDKHGFVSTTILNSMHKYQPRFHLVRA--NDILKLPYSTFRTYVFKETEFIAV 489
            |||.|||||||..|..|.:   |||||||||||.|:|:|  |:......:.|.|:||.||.||:|
Mouse   171 VSFQKLKLTNNHLDPFGHI---ILNSMHKYQPRLHIVKADENNAFGSKNTAFCTHVFPETSFISV 232

  Fly   490 TAYQNEKITQLKIDNNPFAKGFRDTGAGKREKKQALMSNRGSDSDKLNPTHVSSSRAP------- 547
            |:|||.|||||||:||||||||                 ||||...|....:.|...|       
Mouse   233 TSYQNHKITQLKIENNPFAKGF-----------------RGSDDSDLRVARLQSKEYPVISKSIM 280

  Fly   548 ---LHLGHAGRPPHLHP----HAALLDNQQDDDDKLLDVVGPPQSPLLPLS------------HS 593
               |........|.:.|    |.||...|.::...:......||.  |||:            |.
Mouse   281 RQRLVSSQLSAKPDVSPLHSAHQALQHYQYENGAHMQFAAAEPQD--LPLNTFPTQRDSSLFYHC 343

  Fly   594 LQQMHAHQH 602
            |::..:.:|
Mouse   344 LKRRDSARH 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
biNP_001259238.1 Optomotor-blind <260..318 CDD:287988 14/57 (25%)
T-box 330..513 CDD:279278 115/184 (63%)
Tbx4NP_035666.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..50 11/41 (27%)
TBOX 71..260 CDD:238106 120/208 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.