DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bi and tbx-35

DIOPT Version :9

Sequence 1:NP_001259238.1 Gene:bi / 31379 FlyBaseID:FBgn0000179 Length:1023 Species:Drosophila melanogaster
Sequence 2:NP_495059.2 Gene:tbx-35 / 191239 WormBaseID:WBGene00006554 Length:325 Species:Caenorhabditis elegans


Alignment Length:202 Identity:54/202 - (26%)
Similarity:89/202 - (44%) Gaps:18/202 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   332 LEGKDLWEKFHKLGTEMVITKSGRQMFPQMKFRVSGLDAKAKYILLLDIVAADDYRYKFH--NSR 394
            |...|:::.||....|.|:....|..||...|.|..|::...|.:.|.....::.|::|:  ..:
 Worm    27 LHNSDVFQLFHPDIMEQVVVNKERVFFPTPSFNVLNLESDCLYKMSLRFDKTNNKRFQFNRQTKQ 91

  Fly   395 WMVAGKADPEMPKRMYIHPDSPTTGEQWMQKVVSFHKLKLTNNISDKHGFVSTTILNSMHKYQPR 459
            |....|........:::||....||:.||:..|.|. :|:||..|.:...|  ..|.|..||||.
 Worm    92 WTEYDKVSNHKESEVFVHPSEIRTGDDWMKSPVEFF-IKVTNLRSSESDEV--ICLESQCKYQPT 153

  Fly   460 FHLVRANDILKLPYSTFRTY------VFKETEFIAVTAYQNEKITQLKIDNNPFAKGFRDTGAGK 518
            ..:.:   :.:..:..|:.:      .|....|||.|.|.:.:|..:|...|||:.  :||  .|
 Worm   154 LLIQK---VFRDCFGCFQAHGPPVEIKFALLTFIATTRYCSRRIADIKSSLNPFSS--QDT--KK 211

  Fly   519 REKKQAL 525
            :.|:..|
 Worm   212 KNKRNTL 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
biNP_001259238.1 Optomotor-blind <260..318 CDD:287988
T-box 330..513 CDD:279278 49/188 (26%)
tbx-35NP_495059.2 TBOX 23..215 CDD:214656 52/197 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.