Sequence 1: | NP_001259238.1 | Gene: | bi / 31379 | FlyBaseID: | FBgn0000179 | Length: | 1023 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_495059.2 | Gene: | tbx-35 / 191239 | WormBaseID: | WBGene00006554 | Length: | 325 | Species: | Caenorhabditis elegans |
Alignment Length: | 202 | Identity: | 54/202 - (26%) |
---|---|---|---|
Similarity: | 89/202 - (44%) | Gaps: | 18/202 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 332 LEGKDLWEKFHKLGTEMVITKSGRQMFPQMKFRVSGLDAKAKYILLLDIVAADDYRYKFH--NSR 394
Fly 395 WMVAGKADPEMPKRMYIHPDSPTTGEQWMQKVVSFHKLKLTNNISDKHGFVSTTILNSMHKYQPR 459
Fly 460 FHLVRANDILKLPYSTFRTY------VFKETEFIAVTAYQNEKITQLKIDNNPFAKGFRDTGAGK 518
Fly 519 REKKQAL 525 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
bi | NP_001259238.1 | Optomotor-blind | <260..318 | CDD:287988 | |
T-box | 330..513 | CDD:279278 | 49/188 (26%) | ||
tbx-35 | NP_495059.2 | TBOX | 23..215 | CDD:214656 | 52/197 (26%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3585 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |