Sequence 1: | NP_001259238.1 | Gene: | bi / 31379 | FlyBaseID: | FBgn0000179 | Length: | 1023 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_502851.1 | Gene: | tbx-39 / 190678 | WormBaseID: | WBGene00006558 | Length: | 396 | Species: | Caenorhabditis elegans |
Alignment Length: | 303 | Identity: | 77/303 - (25%) |
---|---|---|---|
Similarity: | 127/303 - (41%) | Gaps: | 74/303 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 330 VTLEGKDLWEKFHKLGTEMVITKSG-RQMFPQMKFRVSGLDAKAKYILLLDIVAADDYRYKFHNS 393
Fly 394 RW---MVAGKADPEMPKRMYIHPDSPTTGEQWMQKVVSFHKLKLTNN--ISDKHG--FVSTTILN 451
Fly 452 SMHKYQPRFHLVRANDILKLPYSTFRTYVFKETEFIAVTAYQNEKITQLKIDNNPFAK----GFR 512
Fly 513 DTGAGKREK---------------------------KQALMSNRGSDSDKLNPTHVSSSRAPLH- 549
Fly 550 ---LGHAGRPPHLHP-----------HAALLD---NQQDDDDK 575 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
bi | NP_001259238.1 | Optomotor-blind | <260..318 | CDD:287988 | |
T-box | 330..513 | CDD:279278 | 55/194 (28%) | ||
tbx-39 | NP_502851.1 | T-box | 9..180 | CDD:279278 | 52/183 (28%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3585 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S3847 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.760 |