DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bi and tbx-37

DIOPT Version :9

Sequence 1:NP_001259238.1 Gene:bi / 31379 FlyBaseID:FBgn0000179 Length:1023 Species:Drosophila melanogaster
Sequence 2:NP_499444.2 Gene:tbx-37 / 189977 WormBaseID:WBGene00006556 Length:313 Species:Caenorhabditis elegans


Alignment Length:308 Identity:102/308 - (33%)
Similarity:151/308 - (49%) Gaps:58/308 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   329 KVTLEGKDLWEKFHKLGTEMVIT-KSGRQMFPQMKFRVSGLDAKAKYILLLDIVAADDYRYKFHN 392
            :|:|...::||||:. .|||::| |.||.:||.:.:.|.|||..:.|.:.:.:...|..:|||..
 Worm    11 EVSLNKPEIWEKFYP-KTEMIVTRKRGRVIFPHLDYNVKGLDPDSLYSIYIHLERVDGIKYKFDA 74

  Fly   393 SRWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKVVSFHKLKLTNNISDKHGFVSTTILNSMHKYQ 457
            ..|..|||.||.:|.:...||....||.:||.:.|||..||:||:..:|.  ....:..|:|||.
 Worm    75 GEWKEAGKGDPILPIQYKEHPRGKRTGTEWMSEPVSFAHLKITNDPENKD--QKLILAQSLHKYI 137

  Fly   458 PRFHLVRANDILKLPY-STFR------TYVFKETEFIAVTAYQNEKITQLKIDNNPFAKGFRDTG 515
            |..|:.:.:     || .||:      .:..:.|:||.|||||||::|:||:.:|.||.|||.. 
 Worm   138 PVLHIKQLD-----PYKGTFQMDFHGVEFRLEATQFIVVTAYQNEELTKLKVHHNKFASGFRSN- 196

  Fly   516 AGKREKKQALMSNRGSDSDKLNPTHVSSSRAPLHLGHAGRPPHLHPHAALLDNQQDDDDKLLDVV 580
             |||.     :|:...:|:...|...:|:.:.|      .||.:.|.   :|..|          
 Worm   197 -GKRR-----LSSESENSENSPPKRSASAISSL------TPPAISPP---MDYTQ---------- 236

  Fly   581 GPPQSPLL--------PLSHSLQQMHAHQHSAALAAWFNHLAGAGAGA 620
               |:|..        |.||. .|..||   :|.|..:|:. ||..||
 Worm   237 ---QNPYFFNQNFFSTPQSHQ-PQFAAH---SANAQNYNNF-GAQNGA 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
biNP_001259238.1 Optomotor-blind <260..318 CDD:287988
T-box 330..513 CDD:279278 73/190 (38%)
tbx-37NP_499444.2 TBOX 9..199 CDD:238106 75/197 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.