DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bi and mls-1

DIOPT Version :9

Sequence 1:NP_001259238.1 Gene:bi / 31379 FlyBaseID:FBgn0000179 Length:1023 Species:Drosophila melanogaster
Sequence 2:NP_498640.1 Gene:mls-1 / 186741 WormBaseID:WBGene00003376 Length:252 Species:Caenorhabditis elegans


Alignment Length:187 Identity:92/187 - (49%)
Similarity:130/187 - (69%) Gaps:10/187 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   329 KVTLEGKDLWEKFHKLGTEMVITKSGRQMFPQMKFRVSGLDAKAKYILLLDI--VAADDYRYKFH 391
            :|.|:..:||.:||.|||||::|||||:|||.:...::|||....|::::|:  :....:||.||
 Worm    32 RVFLQSSNLWRRFHNLGTEMIVTKSGRRMFPTLSVIIAGLDPVKSYVVMVDLECIEMKRFRYSFH 96

  Fly   392 NSRWMVAGKADPEMPKRMYIHPDSPTTGEQWMQKVVSFHKLKLTNNISDKHGFVSTTILNSMHKY 456
            .|:|:..|..:.|:|.||::|.|||..|..||:..|||.|:|||||..|.:|.:   |:||||||
 Worm    97 QSKWISTGPGESELPSRMFVHTDSPARGAHWMRAPVSFDKMKLTNNQLDNNGHI---IVNSMHKY 158

  Fly   457 QPRFHLVRANDILKLPYSTFRTYVFKETEFIAVTAYQNEKITQLKIDNNPFAKGFRD 513
            :||.|::..:|..|.     .|:.|:||||||||||||.:||.|||::||||||||:
 Worm   159 RPRVHIIEQDDSQKR-----HTFSFEETEFIAVTAYQNHRITSLKIESNPFAKGFRE 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
biNP_001259238.1 Optomotor-blind <260..318 CDD:287988
T-box 330..513 CDD:279278 91/184 (49%)
mls-1NP_498640.1 TBOX 31..212 CDD:238106 92/187 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2837
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.