DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3626 and CG3270

DIOPT Version :9

Sequence 1:NP_572162.2 Gene:CG3626 / 31377 FlyBaseID:FBgn0029706 Length:939 Species:Drosophila melanogaster
Sequence 2:NP_610228.1 Gene:CG3270 / 35575 FlyBaseID:FBgn0033093 Length:440 Species:Drosophila melanogaster


Alignment Length:464 Identity:123/464 - (26%)
Similarity:180/464 - (38%) Gaps:76/464 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GLSNAVRLSSSQMDPADERVLRKRKFQPQQAADLSEELAGQLPVKSRVVICGGGITGASVAYHLG 88
            ||...:||.:.       |.||....:||  .|:       ||....|:|.|||..|||.|:.|.
  Fly     3 GLRRVLRLGAL-------RQLRSLSGKPQ--GDV-------LPGSCGVLIIGGGGMGASSAFWLK 51

  Fly    89 LR----GWGGETLLVEQDRVGGELPWTACGLAG---RFE-PSYTELKLAEYSIDLIKRLAENGLP 145
            .|    |.....|:||:| .|.....|...:.|   :|. ....|:.|..|:..:..|.....:.
  Fly    52 SRALQLGRKLNVLVVERD-AGYTSASTVLSVGGVRQQFSLAENIEMSLFGYNFVVNGREHLGDVD 115

  Fly   146 TGWRPVGSLNLA-RSWDRMTAFNRMKSQALAWGMHCEILSPEQCAQHCELLSLDGIEGGL-WIPE 208
            ..::|.|.|.|| .....:.|.|......|  |...|:|.||...|....||.:|:|.|. .|.:
  Fly   116 LCYQPNGYLILASEKGAHILAKNSKLQNEL--GARNELLGPEALRQRFPWLSTEGVELGCHGIDK 178

  Fly   209 DGVCDPQLVCQAYMIEAQRLGVRIVEHCAIKKIHSEHGKVRSVETTAGDV--ECEYFVNC----- 266
            :|..||..:...|..:|:.||........:....::.|.:......||||  ....|..|     
  Fly   179 EGWFDPWALLMGYKKKARALGANFANGSVVGFEWNDSGGLSGAVVDAGDVLQRTVKFDTCVLAAG 243

  Fly   267 --TGFWAREVGTLSKPVVKVPLKAV-----EHHYLHT-----KPIEGLSPDTPFVRDFDGRIFFR 319
              :|..||..|...|...:..|...     ...|::.     |...||:  ||...|.||..|.|
  Fly   244 AYSGQVARLAGIGDKEAKEASLSVALPVEPRKRYVYVVSTQGKNCPGLA--TPLTVDPDGTYFRR 306

  Fly   320 E--CEGHILAGGFEREAKMVYEDGVIPLSQTARQHPPDWDHFH---ELLDALLLRVPSFRDATLD 379
            :  | |:.|.|....|.:.       |..:|.     |.||.:   ::...|..|||:|...   
  Fly   307 DGLC-GNFLCGRSPNEDEE-------PECETL-----DVDHGYFETDVWPTLANRVPAFESV--- 355

  Fly   380 RLTNSLQVF----SPDCKWILGEAPEIQNYYVAAGNKTMGVSASGGIGRVLTDLITKGS-TYLDL 439
            ::.:|...|    :.|...::|..|...|.::|||....|:..:..:||.:::||..|. |.|||
  Fly   356 KIQSSWAGFYDHNTFDANGVIGRHPHYSNLFIAAGFSGHGIQQTPAVGRAISELILDGKFTTLDL 420

  Fly   440 HILDISRFL 448
            ..|...|.:
  Fly   421 SRLGFERLV 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3626NP_572162.2 DAO 70..429 CDD:279590 102/396 (26%)
FAO_M 432..487 CDD:292961 7/18 (39%)
GcvT 480..908 CDD:223481
GCV_T 490..774 CDD:279857
GCV_T_C 783..887 CDD:285832
CG3270NP_610228.1 DadA 54..432 CDD:223737 100/397 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13847
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.