DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3626 and AMT

DIOPT Version :9

Sequence 1:NP_572162.2 Gene:CG3626 / 31377 FlyBaseID:FBgn0029706 Length:939 Species:Drosophila melanogaster
Sequence 2:NP_000472.2 Gene:AMT / 275 HGNCID:473 Length:403 Species:Homo sapiens


Alignment Length:390 Identity:86/390 - (22%)
Similarity:152/390 - (38%) Gaps:78/390 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   484 LRMSPIYPQLKEAGAVFGQSMGYERPNYFDQQDKHDEFGLPRFRIAQTRTFGKPPWFDHVASEYR 548
            ||.:|:|......|.......|:..|..:  :|.|.:                    .|:.:   
Human    33 LRRTPLYDFHLAHGGKMVAFAGWSLPVQY--RDSHTD--------------------SHLHT--- 72

  Fly   549 ACRERIGIADYSSF--TKYDFWSKGNEVVDLLQYLCSNDV-DVAVGSIIHTGMQNPNGGYENDCS 610
              |:...:.|.|..  ||.    .|::.|.|::.|...|: ::.......:...|..||..:|..
Human    73 --RQHCSLFDVSHMLQTKI----LGSDRVKLMESLVVGDIAELRPNQGTLSLFTNEAGGILDDLI 131

  Fly   611 LARLSERHYMMIAPTIQQTRSMCWIR---------KHMPNHLR-AKVNVADVTSMYTAICILGPY 665
            :...||.|..::      :.:.||.:         :.:.|..| ..:.|.|    ...:.:.||.
Human   132 VTNTSEGHLYVV------SNAGCWEKDLALMQDKVRELQNQGRDVGLEVLD----NALLALQGPT 186

  Fly   666 SRILLSELTDTDLTPKSFPFFTYKELDVGLADGIRVLNITHTGELGYVLYIPNEYALHVYSRLYQ 730
            :..:|......||  :..||.|...::|....|.||....:|||.|..:.:|...|:|:.:.:.:
Human   187 AAQVLQAGVADDL--RKLPFMTSAVMEVFGVSGCRVTRCGYTGEDGVEISVPVAGAVHLATAILK 249

  Fly   731 AGQKFNIQHAGYYATRALRIEKFYAFWGQDLDTFTTPLECGRSWRV--KFNKPIDFIGRNALLKQ 793
            ..:   ::.||..|..:||:|.....:|.|:|..|||:|...||.:  :....:||.|...::.|
Human   250 NPE---VKLAGLAARDSLRLEAGLCLYGNDIDEHTTPVEGSLSWTLGKRRRAAMDFPGAKVIVPQ 311

  Fly   794 REEGVKRMYVQLLLNDHDHEVDMWCWGG-----EPIYR-DGVYVGMTTTTGYGYTFEKQVCLGFV 852
            .:..|:|..|.|:           |.|.     .||.. :|..:|..|:.....:.:|.|.:|:|
Human   312 LKGRVQRRRVGLM-----------CEGAPMRAHSPILNMEGTKIGTVTSGCPSPSLKKNVAMGYV 365

  Fly   853  852
            Human   366  365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3626NP_572162.2 DAO 70..429 CDD:279590
FAO_M 432..487 CDD:292961 2/2 (100%)
GcvT 480..908 CDD:223481 86/390 (22%)
GCV_T 490..774 CDD:279857 62/296 (21%)
GCV_T_C 783..887 CDD:285832 19/76 (25%)
AMTNP_000472.2 PLN02319 16..400 CDD:177953 86/390 (22%)
GCV_T 39..291 CDD:279857 63/297 (21%)
GCV_T_C 301..392 CDD:285832 19/76 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0404
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.