DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment norpA and sgl

DIOPT Version :9

Sequence 1:NP_001014720.1 Gene:norpA / 31376 FlyBaseID:FBgn0262738 Length:1095 Species:Drosophila melanogaster
Sequence 2:NP_476980.1 Gene:sgl / 38760 FlyBaseID:FBgn0261445 Length:476 Species:Drosophila melanogaster


Alignment Length:466 Identity:89/466 - (19%)
Similarity:167/466 - (35%) Gaps:134/466 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   542 STTNVHPWLSSMVNYAQPIKFQGFDKAIEKNIAHNMSSFAESAGMNYLKQSSIDFVNYNKRQMSR 606
            |:..:..|.|..:    ||...|.|:.::|  ..|::.|..:.....:|::.:.|::.|....:.
  Fly    34 SSERIAQWNSDKL----PIYEPGLDEVVKK--CRNVNLFFSTDIETAIKEADLIFISVNTPTKTC 92

  Fly   607 IYPKGTRADSSNYMPQVFWNAGCQMVSLNFQSSDLPMQLNQGKFEYNGGCGYLLKPDFMRRADKD 671
            ...||..||..      :..:..:|::...||:.:.:                         :|.
  Fly    93 GNGKGRAADLK------YVESAARMIAEIAQSNKIVV-------------------------EKS 126

  Fly   672 FDPFADAPVDGVIAAQCSVKVIAGQFLSDKKVGTYVEVDMFGLPSDTVKKEFRTRLVANNGLNPV 736
            ..|        |.||:..:.::.    :::|.|  :..|:...|      ||   |.....:|.:
  Fly   127 TVP--------VRAAESIMHILR----ANQKPG--IHYDILSNP------EF---LAEGTAINDL 168

  Fly   737 YNEDPFVFRKVVLPD--LAVLRFG-VYE----------------ESGKI-----LGQRILPLDGL 777
            .|.|..:......|:  .||.:.. :||                |..|:     |.|||..::.|
  Fly   169 LNADRVLIGGEETPEGHQAVEKLSWIYEHWIPKQNILTTNTWSSELSKLAANAFLAQRISSINSL 233

  Fly   778 QAGYRHVSLRTEANFPMSLPMLFVNIELKIYVPDGFEDFMAMLSDPRGFAGAAKQQNEQMKALGI 842
            .|    |...|.|:  :|.....|.::.:|    |.:...|.:    ||.|:..|: :.:..:.|
  Fly   234 SA----VCEATGAD--VSEVARAVGLDSRI----GSKFLQASV----GFGGSCFQK-DILNLIYI 283

  Fly   843 EE-----QSGGAARDAGKAKEEEKKEPPLVFEPVTLESLRQEKGFQKVGKKQIKELDTLRKKH-- 900
            .|     :.....:......|.:|:.    |....:|||     |..|..|:|..|....||:  
  Fly   284 CENLNLPEVAAYWQQVIDMNEYQKRR----FSQKIIESL-----FNTVSDKRIAILGFAFKKNTG 339

  Fly   901 -AKERTSVQKTQ-----NAAID----KLIKGKSKDDIRNDA------NIKNSINDQTKQWTDMIA 949
             .:|..::...|     .||:|    |:...:..||:.:.:      .:|.::...:..::.:.|
  Fly   340 DTRETAAITVCQTLLEEGAALDIYDPKVEPEQIIDDLTHPSVTESPEKVKKAVQIHSDPYSAVRA 404

  Fly   950 RHRK---EEWD 957
            .|..   .|||
  Fly   405 THALVICTEWD 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
norpANP_001014720.1 PH_PLC_beta 17..149 CDD:270167
PLN02952 224..786 CDD:178538 49/267 (18%)
EF-hand_like 227..318 CDD:286375
PI-PLCc_beta 318..653 CDD:176533 20/110 (18%)
C2_PLC_like 689..806 CDD:175974 28/140 (20%)
DUF1154 866..908 CDD:284131 12/44 (27%)
Mer2 <887..1003 CDD:286200 19/92 (21%)
sglNP_476980.1 PLN02353 1..459 CDD:177986 89/466 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.