DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mei-9 and MUS81

DIOPT Version :9

Sequence 1:NP_001284859.1 Gene:mei-9 / 31373 FlyBaseID:FBgn0002707 Length:961 Species:Drosophila melanogaster
Sequence 2:NP_001337212.1 Gene:MUS81 / 80198 HGNCID:29814 Length:552 Species:Homo sapiens


Alignment Length:655 Identity:131/655 - (20%)
Similarity:201/655 - (30%) Gaps:264/655 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   361 KLSRQRVFNGQQEFEPEP-CP-----KWQTLTDLLTKEIPGDMRRSR-----------------R 402
            :|.|:|         |.| ||     :|  ||: ...|.....||:|                 |
Human     6 RLGRKR---------PLPACPNPLFVRW--LTE-WRDEATRSRRRTRFVFQKALRSLRRYPLPLR 58

  Fly   403 SEQQPKVLI-----LCQ--DARTCHQLKQYLTQGGPRFLLQQALQHE-VPVGKLSDNYAKESQTR 459
            |.::.|:|.     ||:  |.|    |:::.|.||.......:.::. .|.|:|:     |.|..
Human    59 SGKEAKILQHFGDGLCRMLDER----LQRHRTSGGDHAPDSPSGENSPAPQGRLA-----EVQDS 114

  Fly   460 SAP----PKNVSSNKELRREEVSGSQPPLAGMDELAQLL----SESETEGQHF---EESYMLTMT 513
            |.|    ||...          |||..|.........||    ......|.||   ||.......
Human   115 SMPVPAQPKAGG----------SGSYWPARHSGARVILLVLYREHLNPNGHHFLTKEELLQRCAQ 169

  Fly   514 QPVEVGPAAIDIKPDPDVSIFETIPELEQFDVTAALASVPHQPYICLQTFKTER-----EGSMAL 573
            :...|.|.:  .:|.|                  ||.|:.|:..: |:|.:..|     ||   |
Human   170 KSPRVAPGS--ARPWP------------------ALRSLLHRNLV-LRTHQPARYSLTPEG---L 210

  Fly   574 EHMLEQLQPHYVVMYNMNVTAIRQLEVFEARRRLPPADRMKVYFLIHARTVEE---QAYLTSLRR 635
            |...:..:...:.:.|:.:..           :.||.:...|.....|....|   |.....||.
Human   211 ELAQKLAESEGLSLLNVGIGP-----------KEPPGEETAVPGAASAELASEAGVQQQPLELRP 264

  Fly   636 EKAAFEFIIDTKSKMVIPKYQDGKTDEAFLLLKTYDDEPTDENAKSRQAGGQAPQATKETPKVIV 700
            .:......:|.           |:|                      :.||..|:..:|      
Human   265 GEYRVLLCVDI-----------GET----------------------RGGGHRPELLRE------ 290

  Fly   701 DMREFRSDLPCLIHKRGLEVLPLTIT-----IGDYI-----------------LTPDICVERKSI 743
                             |:.|.:|.|     :||::                 |..|..||||.:
Human   291 -----------------LQRLHVTHTVRKLHVGDFVWVAQETNPRDPAANPGELVLDHIVERKRL 338

  Fly   744 SDLIGSLNSGRLYNQCVQMQR-HYAKPILLIEFDQNKPFH---LQGKFMLSQQTS---------M 795
            .||..|:..||...|..:::| ...:.:.|:|  ::...|   |....:|...|:         .
Human   339 DDLCSSIIDGRFREQKFRLKRCGLERRVYLVE--EHGSVHNLSLPESTLLQAVTNTQVIDGFFVK 401

  Fly   796 ANADIVQKLQLLTLHFPKLRLIWS-----PSPYATAQLFEELKLGKPE------PDPQTAAALGS 849
            ..|||.:....|.|....|:.::.     ..|:.|.        |.||      |:|..:....|
Human   402 RTADIKESAAYLALLTRGLQRLYQGHTLRSRPWGTP--------GNPESGAMTSPNPLCSLLTFS 458

  Fly   850 DEPTAGEQLHFNSGIYDFLLRLPGVHTRNIHGLLRKGGSLRQLLLRSQKELEELLQ----SQESA 910
            |         ||:|                 .:..|..|:|::..|      :|:|    |.|.|
Human   459 D---------FNAG-----------------AIKNKAQSVREVFAR------QLMQVRGVSGEKA 491

  Fly   911 KLLYD 915
            ..|.|
Human   492 AALVD 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mei-9NP_001284859.1 rad1 122..923 CDD:273163 131/655 (20%)
ERCC4 700..832 CDD:280828 33/171 (19%)
MUS81NP_001337212.1 HHH_8 <43..79 CDD:317159 6/35 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 84..130 14/60 (23%)
Interaction with BLM. /evidence=ECO:0000269|PubMed:15805243 125..244 30/163 (18%)
ERCC4 273..416 CDD:308387 36/200 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1948
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.