DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mei-9 and Mus81

DIOPT Version :9

Sequence 1:NP_001284859.1 Gene:mei-9 / 31373 FlyBaseID:FBgn0002707 Length:961 Species:Drosophila melanogaster
Sequence 2:NP_082153.3 Gene:Mus81 / 71711 MGIID:1918961 Length:551 Species:Mus musculus


Alignment Length:584 Identity:116/584 - (19%)
Similarity:179/584 - (30%) Gaps:241/584 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   356 AEQIFKLSRQRVFNGQQEFEPEP-CP-----KWQT--------------------LTDLLTKEIP 394
            ||.: :|.|:|         |.| ||     :|.|                    |..|....:|
Mouse     2 AEPV-RLGRKR---------PLPVCPNPLFVRWLTEWRDEAASRGRHTRFVFQKALRSLQRYPLP 56

  Fly   395 GDMRRSRRSEQQPKVLILCQDARTC----HQLKQYLTQGG-----------------PRFLLQQA 438
                  .||.::.|:|....| |.|    .:|||:|..||                 |    :|.
Mouse    57 ------LRSGKEAKILQHFGD-RLCRMLDEKLKQHLASGGDHAPSSPSGKKGASKGPP----EQV 110

  Fly   439 LQHEVPV------GKLSDNY--AKESQTRS------APPKNVSSNKELRREE------------V 477
            ....:||      |..|..|  |:.|..|.      ....|...:..|.:||            |
Mouse   111 QDSSMPVPTQPQAGSTSVGYWPAQNSGAREILLQLYREHLNSDGHSFLTKEELLQKCAQKTPRVV 175

  Fly   478 SGSQPPLAGMD------------------------ELAQLLSESE----------TEGQHFEESY 508
            .||..|...:.                        ||||.|:|:|          .|..|.|:|.
Mouse   176 PGSSKPWPALRSLLHRNLILGTHRPARYALTPEGLELAQKLAEAEGLSTRHAGFRPEEHHGEDSA 240

  Fly   509 M------------LTMTQPVEVGPA------AIDI--------KPD-----PDVSIFETIPELEQ 542
            :            ....:|:|:.|:      .:||        :|:     ..:.:..|:.:|..
Mouse   241 VPEALSEPGTTEGAVQQRPLELRPSEYRVLLCVDIGETRGAGHRPEMLRELQRLRVPHTVRKLHV 305

  Fly   543 FD-VTAALASVPHQPYICLQTFKTEREGSMALEHMLEQLQPHYVVMYNMNVTAIRQLE-----VF 601
            .| |..|..:.|..|         ||.|.:.|:|::|:                ::|:     :.
Mouse   306 GDFVWVAQETRPRDP---------ERPGELVLDHIVER----------------KRLDDLCSSII 345

  Fly   602 EARRRLPPADRMK-------VYFL-----IHARTVEEQAYLTSLRREKAAFEFIIDTKSKMVIPK 654
            :.|.| ....|:|       ||.:     :|..::.|...|.::...:     :||   ...:.:
Mouse   346 DGRFR-EQKFRLKRCGLGHRVYLVEEHGSVHNLSLPESTLLQAVTNTQ-----VID---GFFVKR 401

  Fly   655 YQDGKTDEAFLLLKTYDDEP--TDENAKSRQAG--GQAPQATKETPKVIVDMREFRSDLPC---- 711
            ..|.|....:|.|.|...|.  .....:||..|  |.|....|.:...:..:..| ||...    
Mouse   402 TMDIKESAGYLALLTKGLERLYQGHTLRSRPWGAPGAAESEAKPSTNPLCSLLTF-SDFNAEAVK 465

  Fly   712 -------------LIHKRGLEVLPLTITIGDYILTP-------DICVERKSISDLIGSLNSGRL 755
                         |:..|||........:..| .||       |.|...|....|:.::..|||
Mouse   466 NKAQSVREVFARQLMQVRGLSGEKAAAVVDRY-STPASLLAAYDACATAKEQEMLLSTIKCGRL 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mei-9NP_001284859.1 rad1 122..923 CDD:273163 116/584 (20%)
ERCC4 700..832 CDD:280828 17/80 (21%)
Mus81NP_082153.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 84..131 9/50 (18%)
Interaction with BLM. /evidence=ECO:0000250 125..244 24/118 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 229..259 4/29 (14%)
MUS81 248..515 CDD:224859 55/302 (18%)
ERCC4 273..415 CDD:280828 31/175 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1948
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.