DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mei-9 and Mus81

DIOPT Version :9

Sequence 1:NP_001284859.1 Gene:mei-9 / 31373 FlyBaseID:FBgn0002707 Length:961 Species:Drosophila melanogaster
Sequence 2:XP_008758328.1 Gene:Mus81 / 293678 RGDID:1311957 Length:563 Species:Rattus norvegicus


Alignment Length:462 Identity:105/462 - (22%)
Similarity:153/462 - (33%) Gaps:122/462 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   345 LSNSGWTLLDAAEQIFKLSRQ--RVFNGQQEFEPEPCPKWQTLTDLLTKEIPGDMRRSRRSEQQP 407
            |::.|.:.|...|.:.|.:::  ||.       ||....|..|..||.:.:.....|..|....|
  Rat   150 LNSDGHSFLTKEELLQKCAQKTPRVV-------PESSRPWPALRGLLHRNLVLRTHRPARYALTP 207

  Fly   408 KVLILCQDARTCHQLKQYLTQGGPRFLLQQALQ----HE---VPVGKLSDNYAKESQTRSAPPKN 465
            :.|          :|.|.|.:......|..|.|    ||   ||...||:.:...:|    ||.:
  Rat   208 EGL----------ELAQKLAEAEGLSTLNTAFQPEEHHEESPVPEAILSEPFWPYAQ----PPLH 258

  Fly   466 VSSNKELRREEVSGSQPPL-AGMDELAQLL--SESETEGQ-HFEESYMLTMTQPVEVGPAAIDIK 526
            .|..     .||...|.|| ....|...||  ...||.|. |..|  ||...|.:.|.       
  Rat   259 CSGT-----TEVGVQQRPLELRPSEYRVLLCVDIGETRGAGHRPE--MLRELQRLRVP------- 309

  Fly   527 PDPDVSIFETIPELEQFD-VTAALASVPHQPYICLQTFKTEREGSMALEHMLEQLQPHYVVMYNM 590
                    .|:.:|...| |..|..:.|..|         ||.|.:.|:|::|:           
  Rat   310 --------HTVRKLHVGDFVWVAQETRPRDP---------ERPGELVLDHIVER----------- 346

  Fly   591 NVTAIRQLE-----VFEARRRLPPADRMKVYFLIH-ARTVEEQAYLTSLR-REKAAFEFIIDTK- 647
                 ::|:     :.:.|.| ....|:|...|.| ...|||...:.:|. .|....:.:.:|: 
  Rat   347 -----KRLDDLCSSIIDGRFR-EQKFRLKRCGLGHRIYLVEEHGSVQNLSLPESTLLQAVTNTQV 405

  Fly   648 -SKMVIPKYQDGKTDEAFLLLKTYDDEP--TDENAKSRQAG--GQAPQATKETPKVIVDMREFRS 707
             ....:.:..|.|....:|.|.|...|.  ......||..|  |.|....|.:...:..:..| |
  Rat   406 IDGFFVKRTMDIKESAGYLALLTKGLERLYQGHTLHSRPWGTPGDAESEAKPSTNPLCSLLTF-S 469

  Fly   708 DLPC-----------------LIHKRGLEVLPLTITIGDYILTP-------DICVERKSISDLIG 748
            |...                 |:..|||........:..| .||       |.|...|....|:.
  Rat   470 DFNAEAVKNKAQSVREVFARQLMQVRGLSGEKAAALVDRY-STPASLLAAYDACATTKEQEMLLS 533

  Fly   749 SLNSGRL 755
            ::..|||
  Rat   534 TVKCGRL 540

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mei-9NP_001284859.1 rad1 122..923 CDD:273163 105/462 (23%)
ERCC4 700..832 CDD:280828 17/80 (21%)
Mus81XP_008758328.1 ERCC4 285..427 CDD:280828 38/184 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1948
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.