DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12692 and KLHL13

DIOPT Version :9

Sequence 1:NP_001284857.1 Gene:CG12692 / 31372 FlyBaseID:FBgn0029703 Length:553 Species:Drosophila melanogaster
Sequence 2:XP_011529711.1 Gene:KLHL13 / 90293 HGNCID:22931 Length:661 Species:Homo sapiens


Alignment Length:245 Identity:53/245 - (21%)
Similarity:97/245 - (39%) Gaps:52/245 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 LEELRKLMLQRIGAAFLAVLGGDDFQRMPLEDVITMLQQDSLGVNSEMEVLVAIIRWLNCQSKCI 239
            |.|:.|.:...:...|.|:|...:|.::|.|.:..:|..:||...:|:|:..|..|||..:...:
Human   214 LTEVDKYVNSFVLKNFPALLSTGEFLKLPFERLAFVLSSNSLKHCTELELFKATCRWLRLEEPRM 278

  Fly   240 DQATPLLMDCLRLTLLPLPILKRFWRCAMAPPVPDEPFMNAVRGNIHIRERISCAITVVQ----- 299
            |.|..|:.: :|..|:                .|.| .:|.|:....:|...:|...:::     
Human   279 DFAAKLMKN-IRFPLM----------------TPQE-LINYVQTVDFMRTDNTCVNLLLEASNYQ 325

  Fly   300 -MHHLHTSRREFLDFCRS------------KGLLVDMPREWIYDEQCHYH---LPRPGGPYSHLI 348
             |.::....:......||            :..||......:|||:.|..   .|.....|.|.|
Human   326 MMPYMQPVMQSDRTAIRSDTTHLVTLGGVLRQQLVVSKELRMYDEKAHEWKSLAPMDAPRYQHGI 390

  Fly   349 CV-----HVI---SNYAIQRAQRLMESSKRWPRRVNTYMPPSDDLQTINE 390
            .|     :|:   |||. .:.:..:::..|:..|.|.:|    .:.::||
Human   391 AVIGNFLYVVGGQSNYD-TKGKTAVDTVFRFDPRYNKWM----QVASLNE 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12692NP_001284857.1 BACK 162..265 CDD:285009 23/89 (26%)
KLHL13XP_011529711.1 BTB_POZ_KLHL9_13 75..202 CDD:349548
PHA03098 98..641 CDD:222983 53/245 (22%)
KELCH repeat 385..433 CDD:276965 12/52 (23%)
KELCH repeat 437..481 CDD:276965
KELCH repeat 484..529 CDD:276965
KELCH repeat 531..580 CDD:276965
KELCH repeat 583..630 CDD:276965
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.