DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12692 and KLHL31

DIOPT Version :9

Sequence 1:NP_001284857.1 Gene:CG12692 / 31372 FlyBaseID:FBgn0029703 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_001003760.2 Gene:KLHL31 / 401265 HGNCID:21353 Length:634 Species:Homo sapiens


Alignment Length:509 Identity:103/509 - (20%)
Similarity:162/509 - (31%) Gaps:178/509 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 IGTST--FWCTSSLLQFHSNYFDRNICPVNCFREGTDL-------IAVGFRAAYTWMRLQEPLDP 122
            |||.|  |....|::...|.|| .||...:...:..||       :|.....|||          
Human    77 IGTKTKSFDVHKSVMASCSEYF-YNILKKDPSIQRVDLNDISPLGLATVIAYAYT---------- 130

  Fly   123 FMQPDKLMTLLHT-------AVQLEMPALKALCYEQLCTDRFREETAFQVYLRALKYPQLEELRK 180
                .||...|:|       ||.|::..|..:|.:.|..:...|...:.|.: |..| .|:..:.
Human   131 ----GKLTLSLYTIGSIISAAVYLQIHTLVKMCSDFLIREMSVENCMYVVNI-AETY-SLKNAKA 189

  Fly   181 LMLQRIGAAFLAVLGGDDFQRMPLEDVITMLQQDSLGVNSEMEVLVAIIRWLNCQSKCIDQATPL 245
            ...:.|...||.....|.|.::..|.:..:|..|.|.:.||:......::||....|.:..|..|
Human   190 AAQKFIRDNFLEFAESDQFMKLTFEQINELLIDDDLQLPSEIVAFQIAMKWLEFDQKRVKYAADL 254

  Fly   246 LMDCLRLTLLPLPILKRFWRCAMAPPVPDEPFMNAVRGNIHIRERISCAITVVQMHHLH------ 304
            |.:.            ||      ..:..:..:|.|:....:.:...|...:|...:.|      
Human   255 LSNI------------RF------GTISAQDLVNYVQSVPRMMQDADCHRLLVDAMNYHLLPYHQ 301

  Fly   305 ----TSRREFLDFCRSKGLLV-----------DMPREWIYDEQCHYHLPRPGGPYSHLI------ 348
                :.|......||   :||           .:.|:.:|.:        |...:|.|.      
Human   302 NTLQSRRTRIRGGCR---VLVTVGGRPGLTEKSLSRDILYRD--------PENGWSKLTEMPAKS 355

  Fly   349 ---CVHVI-----------SNYAIQRAQRLMESSKRWPRRVNTYMPPSDDLQTINELPEDKDEEA 399
               ||.|:           .|.|..:|:..:.:..|:..|.||::    .|.::|:    |....
Human   356 FNQCVAVMDGFLYVAGGEDQNDARNQAKHAVSNFCRYDPRFNTWI----HLASMNQ----KRTHF 412

  Fly   400 QVSVEPSAPEMSEGLPQPEEDDCFIARLFRGTLLRLNEVMAAQDRNIERRIDNL----------- 453
            .:||                        |.|.      |.||..||.|..:.:|           
Human   413 SLSV------------------------FNGL------VYAAGGRNAEGSLASLECYVPSTNQWQ 447

  Fly   454 ---------------IRDG--TLRPRFIPNAMSRFVLPTAMTCA---AQEDLQE 487
                           :.||  .:...:|.||.||.|      ||   |.:..||
Human   448 PKTPLEVARCCHASAVADGRVLVTGGYIANAYSRSV------CAYDPASDSWQE 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12692NP_001284857.1 BACK 162..265 CDD:285009 23/102 (23%)
KLHL31NP_001003760.2 BTB 63..164 CDD:279045 26/101 (26%)
PHA03098 73..601 CDD:222983 103/509 (20%)
BACK 172..273 CDD:285009 24/120 (20%)
Kelch 1 317..365 10/55 (18%)
KELCH repeat 356..405 CDD:276965 11/52 (21%)
Kelch 2 366..419 13/84 (15%)
Kelch 367..419 CDD:128874 13/83 (16%)
KELCH repeat 409..453 CDD:276965 11/73 (15%)
Kelch 420..466 CDD:128874 7/51 (14%)
Kelch 3 420..466 7/51 (14%)
Kelch_1 455..500 CDD:279660 13/47 (28%)
KELCH repeat 456..501 CDD:276965 13/46 (28%)
Kelch 4 468..513 11/34 (32%)
Kelch_1 502..552 CDD:279660
KELCH repeat 503..551 CDD:276965
Kelch 5 515..565
KELCH repeat 555..602 CDD:276965
Kelch 6 567..614
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.