DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12692 and CG9970

DIOPT Version :9

Sequence 1:NP_001284857.1 Gene:CG12692 / 31372 FlyBaseID:FBgn0029703 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_647754.1 Gene:CG9970 / 38351 FlyBaseID:FBgn0035380 Length:484 Species:Drosophila melanogaster


Alignment Length:350 Identity:107/350 - (30%)
Similarity:162/350 - (46%) Gaps:25/350 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 GAVTRVCIGTSTFWCTSSLLQFHSNYFDRNICPVNCFR-EGTDLIAVGFRAAYTWMRLQEPLDPF 123
            ||:..|.||.:.|.|...||:..|.:|......:..|: :..::.:.||:..|.|||..: |..|
  Fly   146 GALALVQIGENKFKCIPCLLRCFSVWFGIRDWRITRFKFKEREVPSGGFKVVYEWMRTNK-LPEF 209

  Fly   124 MQPDKLMTLLHTAVQLEMPALKALCYEQLCTDRFREETAFQVYLRALKYPQLEELRKLMLQRIGA 188
               |:|:..|..|..|::..|:...::.|..:..||:.||.|||.|.:.|.|..|.:.||.|:..
  Fly   210 ---DELVPALQVACHLKVTLLEKEIWQILSDESVREKVAFLVYLGARRMPALGALCEAMLFRLRK 271

  Fly   189 AFLAVLGGDDFQRMPLEDVITMLQQDSLGVNSEMEVLVAIIRWL-NCQSKCIDQATPLLMDCLRL 252
            .|||::|...|.|:.::.:..:|:|||:||||||||..|:|||| :.:.:...:....||.|:|.
  Fly   272 YFLALVGSPHFVRLKVDVLEMLLRQDSIGVNSEMEVFFAVIRWLGHSRGRKRREHFQRLMKCVRF 336

  Fly   253 TLLPLPILKRFWRCAMAPPVPD----EPFMNAVRGNIHIRERISCAITVVQMHHLHTSRREFLDF 313
            ..:|:..|.........|...|    ||.|.|...:..:.|.:..||..:.:........|||..
  Fly   337 HHMPMTFLFSLRESFNHPEKFDLFSKEPGMLAFNTDPEMMELLEHAIYFISVRTQCDDINEFLST 401

  Fly   314 CRSKGLLVDMPREWIYDEQCHYHLPRPGGPYSHLICVHVISNY--AIQRAQRLMESSKRWPRRVN 376
            |.|..:.|.:||.|:|...|.:||.....||.|........:|  :||         |.|..:  
  Fly   402 CESHHIEVVLPRWWVYHVNCPFHLRTIDFPYQHRFTATDFGDYIDSIQ---------KVWSGK-- 455

  Fly   377 TYMPPSDDLQTINELPEDKDEEAQV 401
              .||.|....:.:|..|.....||
  Fly   456 --GPPDDGKDLVIDLALDPLRGGQV 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12692NP_001284857.1 BACK 162..265 CDD:285009 41/103 (40%)
CG9970NP_647754.1 BACK 254..346 CDD:197943 35/91 (38%)
DUF4734 373..450 CDD:292506 22/85 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469506
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H119992
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006713
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22667
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.