DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12692 and CG15097

DIOPT Version :10

Sequence 1:NP_572159.1 Gene:CG12692 / 31372 FlyBaseID:FBgn0029703 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_001261079.1 Gene:CG15097 / 37172 FlyBaseID:FBgn0034396 Length:743 Species:Drosophila melanogaster


Alignment Length:314 Identity:58/314 - (18%)
Similarity:101/314 - (32%) Gaps:109/314 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 DFHASVFRSL------GAVTRVCIGTSTFWCTSSLLQFHS------NYFDRNICPVNCFREGTDL 102
            |..:|..|.|      |.:|............|.|||.||      .:..|.:.|.||       
  Fly   117 DVDSSALRQLIDYTYTGEITITEQNVQVLLPASGLLQMHSVRDACCKFLLRQLHPSNC------- 174

  Fly   103 IAVGFRAAYTWMRLQEPLDPFMQPDKLMTLLHTAVQLEMPALKALCYEQLCTDRFREETAFQVYL 167
              :|.|:.......:|              |||                                
  Fly   175 --LGIRSFADAHSCKE--------------LHT-------------------------------- 191

  Fly   168 RALKYPQLEELRKLMLQRIGAAFLAVLGGDDFQRMPLEDVITMLQQDSLGVNSEMEVLVAIIRWL 232
            |:.||         .||.    |..|:|.::|..:|.|:|..::....|.::||..|..|:|.|:
  Fly   192 RSHKY---------ALQN----FQQVVGTEEFLLLPFEEVRELISNSQLNISSEERVFAAVINWV 243

  Fly   233 NCQSKCIDQATPLLMDCLRLTLLPLPILKRFWRCAMAPPVPDEPFMNAVRGNIHIRERISCAITV 297
            .     .|..|..|.....::.:.||::.|            :..|:.|.....:|:...|...:
  Fly   244 K-----HDLPTRRLHIAELMSNVRLPLVSR------------DFLMSCVETETLMRDDSECKELL 291

  Fly   298 VQ--MHHLHTSRREFLDFCRSKGLLVDMPREWIY----------DEQCHYHLPR 339
            ::  .:||...:|..:...|::....:..:.:::          ..:|..:.||
  Fly   292 LEAMKYHLLPEQRSIMGSQRTQERRPEGMKPYVFAVGGGSLFAIHNECEVYNPR 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12692NP_572159.1 BACK 162..265 CDD:462237 25/102 (25%)
CG15097NP_001261079.1 BTB_POZ 51..171 CDD:453885 13/53 (25%)
PHA03098 65..539 CDD:222983 58/314 (18%)
BACK 169..282 CDD:475122 36/197 (18%)
KELCH repeat 359..402 CDD:276965
KELCH repeat 406..450 CDD:276965
KELCH repeat 453..496 CDD:276965
KELCH repeat 500..545 CDD:276965
KELCH repeat 547..590 CDD:276965
Kelch 559..603 CDD:128874
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.