DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12692 and CG12857

DIOPT Version :9

Sequence 1:NP_001284857.1 Gene:CG12692 / 31372 FlyBaseID:FBgn0029703 Length:553 Species:Drosophila melanogaster
Sequence 2:NP_610987.1 Gene:CG12857 / 36642 FlyBaseID:FBgn0033963 Length:440 Species:Drosophila melanogaster


Alignment Length:304 Identity:75/304 - (24%)
Similarity:130/304 - (42%) Gaps:28/304 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 PCNDAMDFHASVFR-----SLGAVTRVCIGTSTFWCTSSLLQFHSNYF-DRNICPVNCFREGTDL 102
            ||.|.:   |:|.|     .|....::.|....|.|...:||.:|.:| :..:.|:........:
  Fly    95 PCKDRL---ATVLRYMFESHLKTTVQIEINNMYFNCHFIVLQVYSRFFSELEMIPLLVTLPEKIV 156

  Fly   103 IAVGFRAAYTWMRLQEPLDPFMQPDKLMTLLHTAVQLEMPALKALCYEQLCTDR-FREETAFQVY 166
            ....|..:|.||...||:   ::...::.:...|..|.:..|.|.|::....:. :.|:||..:|
  Fly   157 SQKAFMLSYKWMLSDEPV---LELAHIVEVYVAATYLRISGLAAHCWKYFDDEEYYNEDTACVLY 218

  Fly   167 LRALKYPQLEELRKLMLQRIGAAFLAVLGGDDFQRMPLEDVITMLQQDSLGVNSEMEVLVAIIRW 231
            :.:...|.::.:|.|||.||....|..:...||..:|...:|.:|:.|.:.||:|:||....:||
  Fly   219 VESKDNPAMDVVRNLMLTRIRKFLLTFVATRDFLDLPTSHLIFLLESDQICVNTEIEVFFIAVRW 283

  Fly   232 LNCQSKCIDQATPLLMDCLRLTLLPLPILKRFWRCAMAPPVPDEPFMNAVRGNIHIRERISCAIT 296
            |.............||.|:|..|:||      |....|....|.|.:..:..|..:..:|..:|:
  Fly   284 LGHDWNKRKVHVRRLMSCIRFNLMPL------WYLLYARREEDHPLVMKLIFNPEVEYKIDESIS 342

  Fly   297 VV--QMHH--LHTSRREFLDFCRSKGLLVDMPREWIYDEQCHYH 336
            .:  :|:.  |..:..:..::....|     .|.||.|..|.|:
  Fly   343 RITSRMYEDALEGNDAQSEEYASDSG-----QRNWICDSLCSYY 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12692NP_001284857.1 BACK 162..265 CDD:285009 31/102 (30%)
CG12857NP_610987.1 BTB 104..199 CDD:295341 20/97 (21%)
BACK 215..313 CDD:197943 31/103 (30%)
DUF4734 327..415 CDD:292506 12/60 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469523
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H119992
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006713
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22667
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.