DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc4B and C11orf24

DIOPT Version :9

Sequence 1:NP_001284856.1 Gene:Muc4B / 31368 FlyBaseID:FBgn0052774 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_071733.1 Gene:C11orf24 / 53838 HGNCID:1174 Length:449 Species:Homo sapiens


Alignment Length:415 Identity:122/415 - (29%)
Similarity:173/415 - (41%) Gaps:83/415 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 ETITINISEIIAAAEAASNTTESSSTTA----PLSTTTEATS-TSTASSATS------------T 97
            ||:....||.:..| |||..|.:..|:|    .:..|||.|| |..:..|||            |
Human    45 ETVDNKTSEDVTMA-AASPVTLTKGTSAAHLNSMEVTTEDTSRTDVSEPATSGGAADGVTSIAPT 108

  Fly    98 TVPASTTLTSSSTTQAGITTSTETSTSAQSTSTI--LADT---------STTPNTPTITTETSQS 151
            .|.:|||..|.:|..:.:|.::...|:|.|::|:  :|.|         |:||.|..:...||.|
Human   109 AVASSTTAASITTAASSMTVASSAPTTAASSTTVASIAPTTAASSMTAASSTPMTLALPAPTSTS 173

  Fly   152 TVTQAPTTL--QPSITT--TQASTTTQLPTTSTSITITTTQASTTTTQTSTAAP-STTTTP---- 207
            |.....||.  .||::|  .|...::.||.|:|..|: .|:|.|..|..:|::| ||..:|    
Human   174 TGRTPSTTATGHPSLSTALAQVPKSSALPRTATLATL-ATRAQTVATTANTSSPMSTRPSPSKHM 237

  Fly   208 PSTTSTTQAPTTTTLVQA--STTTTLQPTTSTTPQSTSTTSTQAPTTTTTQSTSTATQPSTTTPQ 270
            ||.|:.:..|......|.  |..:..||..:||.:||                   ..||.|||:
Human   238 PSDTAASPVPPMRPQAQGPISQVSVDQPVVNTTNKST-------------------PMPSNTTPE 283

  Fly   271 SPPTTTTQVSTTSTQ---PTTTTTPLPTTTTTP-----LPTTTTTPLPTTTTTPLPTTTSTPQPT 327
            ..||.|. |:||..|   ||.:..|:|.|:..|     .|||..:|:|.|.....|.|:..|:..
Human   284 PAPTPTV-VTTTKAQAREPTASPVPVPHTSPIPEMEAMSPTTQPSPMPYTQRAAGPGTSQAPEQV 347

  Fly   328 TTTTPQPTTTTVPT---------TTTTTTQASTTSQSEITTTPAPTSSTEIGTT----TTTAGST 379
            .|.....|.:|.||         ..|.:.|.||..|..:.|| .|.:...:..|    ....|.|
Human   348 ETEATPGTDSTGPTPRSSGGTKMPATDSCQPSTQGQYMVVTT-EPLTQAVVDKTLLLVVLLLGVT 411

  Fly   380 TTSTTTTSTTPIAYTVYTMEPYPNI 404
            ...|........||..|..:.|..:
Human   412 LFITVLVLFALQAYESYKKKDYTQV 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc4BNP_001284856.1 None
C11orf24NP_071733.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 72..101 9/28 (32%)
PHA03247 <133..391 CDD:223021 85/279 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 154..187 10/32 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 215..381 54/185 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.