DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15570 and MOBP

DIOPT Version :10

Sequence 1:NP_572154.1 Gene:CG15570 / 31366 FlyBaseID:FBgn0029697 Length:1357 Species:Drosophila melanogaster
Sequence 2:NP_001265251.1 Gene:MOBP / 4336 HGNCID:7189 Length:206 Species:Homo sapiens


Alignment Length:115 Identity:29/115 - (25%)
Similarity:47/115 - (40%) Gaps:11/115 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly  1217 GKTTTVAPTQSPTESPTESPTGSPTDSPTQSPTETPTYGPPTNEPPTNQPPTNQPPTVQPPTNQP 1281
            |...|....:|| :.|.:.|...|  :..::|.: |...|.:...|.:.|.:.:.|...|.:.:.
Human    90 GPLRTSRRAKSP-QRPKQQPAAPP--AVVRAPAK-PRSPPRSERQPRSPPRSERQPRSPPRSERQ 150

  Fly  1282 PTNQPPTNQPPTNQPPTNQPPTNQPP----TNQP---PTNEPPTNRPPSP 1324
            |.:.|.:.:.|..:|....||..|.|    ..||   |...|..:|..||
Human   151 PRSPPRSERQPRPRPEVRPPPAKQRPPQKSKQQPRSSPLRGPGASRGGSP 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15570NP_572154.1 FhaB <413..1245 CDD:442443 7/27 (26%)
PHA03247 <1216..1326 CDD:223021 29/115 (25%)
MOBPNP_001265251.1 PHD_SF <1..68 CDD:473978
PHA03247 <84..200 CDD:223021 27/113 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.