DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15570 and idpp-3

DIOPT Version :10

Sequence 1:NP_572154.1 Gene:CG15570 / 31366 FlyBaseID:FBgn0029697 Length:1357 Species:Drosophila melanogaster
Sequence 2:NP_510481.1 Gene:idpp-3 / 181589 WormBaseID:WBGene00009720 Length:241 Species:Caenorhabditis elegans


Alignment Length:146 Identity:42/146 - (28%)
Similarity:50/146 - (34%) Gaps:37/146 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly  1208 ITNVANDCSGKTTTVAPTQSPTESPTESPTGSPTDSPTQSPTETPTYGP-PTNEPPTNQPPTNQP 1271
            :.|:..:|.|         :|..||:..|...|...|...|..:|..|| |...|....||....
 Worm    63 VFNIHFNCCG---------APRPSPSCCPYVPPAPLPPPPPPASPCCGPSPVPAPCCPPPPAPAA 118

  Fly  1272 PTVQPPTNQPPTNQP-------PTNQPPTNQ-------PPTNQP--------PTNQPPTNQP-PT 1313
            |...||  .|||..|       |..:.|..|       ||.:.|        |||  |..|| |.
 Worm   119 PCCPPP--PPPTPSPLVCCKQAPVPENPCCQIVAAAMPPPPSAPACCVAAPVPTN--PCCQPAPR 179

  Fly  1314 NEPPTNRPPSPSPNNC 1329
            ..|.....|.|.|..|
 Worm   180 PAPCVCSAPRPVPCRC 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15570NP_572154.1 FhaB <413..1245 CDD:442443 8/36 (22%)
PHA03247 <1216..1326 CDD:223021 38/133 (29%)
idpp-3NP_510481.1 None

Return to query results.
Submit another query.