DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fas2 and IL1RL1

DIOPT Version :9

Sequence 1:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster
Sequence 2:NP_057316.3 Gene:IL1RL1 / 9173 HGNCID:5998 Length:556 Species:Homo sapiens


Alignment Length:475 Identity:105/475 - (22%)
Similarity:147/475 - (30%) Gaps:143/475 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 VEGKPFAANCTARGKPVPEISWIRDATQLNVATADRFQVNPQTGLVTISSVSQDDYGTYTCLAK- 305
            :|.:.....|..:|||...:.|....|..::.|.:|.:|.....|:.....:..|.|.|||:.: 
Human    27 LENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCIVRS 91

  Fly   306 ---NRAG-----VVDQKTKLNVLVRPQIYELYNVTGARTKEIAITCRAKGRPAPAITFRRW-GTQ 361
               ||.|     :..:::..||   |. |.:|:......|...|.|       |.|....| ...
Human    92 PTFNRTGYANVTI
YKKQSDCNV---PD-YLMYSTVSGSEKNSKIYC-------PTIDLYNWTAPL 145

  Fly   362 EEYTNGQQDDDPRIILEPNFDEERGESTGTLRISNAERSDDGLYQC--IARNKGAD--AYKTGHI 422
            |.:.|.|.....|.....:|          |.|.|....|.|.|.|  |....||:  ...|...
Human   146 EWFKNCQALQGSRYRAHKSF----------LVIDNVMTEDAGDYTCKFIHNENGANYSVTATRSF 200

  Fly   423 TVEFAPDFSHMKELPPVFSWEQ----------RKANLSCLA-MGIPN---ATIEWHWNGRKIKDL 473
            ||:....||    |.||.....          :.|||:|.| .|...   |.:.|..||.||.|.
Human   201 TVKDEQGFS----LF
PVIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDF 261

  Fly   474 ---------------------YDTNLKIVGTGPRSDLIVHPVTRQYYSGYKCIATNIHGTAEHDM 517
                                 .|..|:|... ...||::.         |.|:|.|:||...|.:
Human   262 GEPRIQQEEGQNQSFSNGLACLDMVLRIADV-KEEDLLLQ---------YDCLALNLHGLRRHTV 316

  Fly   518 QLKEARVPD--------------------FVSEAKPSQLTATTMTFDIRGP-----STELGLPIL 557
            :|......|                    .|...|...:.||.:..||..|     ..:|....:
Human   317 RLSRKNPIDHHSIYCIIAVCSVFLMLINVLVIILKMFWIEATLLWRDIAKPYKTRNDGKLYDAYV 381

  Fly   558 AYSVQYKEALN-------------PD--------WSTAYNRSWSPDSPYI--VEG---------- 589
            .|...||.:.:             ||        ....|.|...|....:  ||.          
Human   382 VYPRNYKSSTDGASRVEHFVHQILPDVLENKCGYTLCIYGRDMLPGEDVVTAVETNIRKSRRHIF 446

  Fly   590 -LRPQTEYSFRFAARNQVGL 608
             |.||..::..||...:|.|
Human   447 ILTPQITHNKEFAYEQEVAL 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fas2NP_001284854.1 IG_like 39..133 CDD:214653
IG_like 144..226 CDD:214653
IGc2 152..209 CDD:197706
I-set 230..319 CDD:254352 19/85 (22%)
IGc2 243..309 CDD:197706 18/69 (26%)
IG_like 330..424 CDD:214653 22/98 (22%)
IGc2 339..412 CDD:197706 18/75 (24%)
Ig 447..518 CDD:143165 25/95 (26%)
fn3 534..611 CDD:278470 23/114 (20%)
FN3 640..735 CDD:238020
IL1RL1NP_057316.3 Ig 16..104 CDD:299845 19/76 (25%)
IG_like 21..104 CDD:214653 19/76 (25%)
Ig2_IL1R_like 118..204 CDD:143234 25/102 (25%)
IG_like 120..197 CDD:214653 21/93 (23%)
Flexible linker 198..211 4/16 (25%)
TIR 380..535 CDD:279864 17/87 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.