DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fas2 and IL18RAP

DIOPT Version :9

Sequence 1:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster
Sequence 2:NP_001380415.1 Gene:IL18RAP / 8807 HGNCID:5989 Length:599 Species:Homo sapiens


Alignment Length:496 Identity:103/496 - (20%)
Similarity:181/496 - (36%) Gaps:124/496 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 VPE--PSL----VADLQWKDNRNNTILPKPNGRNQPPMYTETLPGESLALMITSLSVEMGGKYYC 116
            |||  |.:    ::|:||....:|.. |..:.|...|...:    :...|...:..|...|.|.|
Human    67 VPEHLPFMGSNDLSDVQWYQQPSNGD-PLEDIRKSYPHIIQ----DKCTLHFLTPGVNNSGSYIC 126

  Fly   117 TASYANTE---------ILEKGVTIKTYVAITWTNAPENQYPTLGQDYVVMC---EVKAD-PNPT 168
            ......:.         |||  |..:|..:..: :|...|...||....:.|   ..::| .:|.
Human   127 RPKMIKSPYDVACCVKMILE--VKPQTNASCEY-SASHKQDLLLGSTGSISCPSLSCQSDAQSPA 188

  Fly   169 IDWLRNGDPIRTTNDKYVVQTNGLLIRNVQESDEGIYTCR------------AAVIETGELLERT 221
            :.|.:||..:.      |.::|.:::..|.:..:|.|.|.            .||::.     ||
Human   189 VTWYKNGKLLS------VERSNRIVVDEVYDYHQGTYVCDYTQSDTVSSWTVRAVVQV-----RT 242

  Fly   222 IRVEVFIQPEIIS-LPTNLEAVEGKPFAANCTAR------GKPVPEISW-IRDAT---QLNVATA 275
            |..:..::|:|:. :...||...|||...:|.||      ..||  |.| |:|:.   :::|..|
Human   243 IVGDTKLKPDILDPVEDTLEVELGKPLTISCKARFGFERVFNPV--IKWYIKDSDLEWEVSVPEA 305

  Fly   276 DRFQVNPQTGL----VTISSVSQDDY-GTYTCLAKNRAGVVDQ----KTKLNVLVRPQIYELYNV 331
            ...:...:..:    :.:..|:|.|. ..:.|..:|..|...|    |.|..|::   :|.|...
Human   306 KSIKSTLKDEIIERNIILEKVTQRDLRRKFVCFVQNSIGNTTQSVQLKEKRGVVL---LYILLGT 367

  Fly   332 TGARTKEIAITCRAKGRPAPAITFRRW---------GTQEEYTNGQQDDDPRIILEPNFDEERGE 387
            .|.....:|         |.|:.:|.|         ...::.|.|.:.|....:....:.....|
Human   368 IGTLVAVLA---------ASALLYRHWIEIVLLYRTYQSKDQTLGDKKDFDAFVSYAKWSSFPSE 423

  Fly   388 STGTLRISNAERSDDGLYQCIARNKGADAYKTGHITVEFAPDFSHMKELPPVFSWEQRKANLSCL 452
            :|.:|   :.|.....|:..:..||  ..|....:..:.||...:.:::..:....:|       
Human   424 ATSSL---SEEHLALSLFPDVLENK--YGYSLCLLERDVAPGGVYAEDIVSIIKRSRR------- 476

  Fly   453 AMGI----PNATIEWHWNGRKIKDLY--------DTNLKIV 481
              ||    ||     :.||..|.:|.        |..||::
Human   477 --GIFILSPN-----YVNGPSIFELQAAVNLALDDQTLKLI 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fas2NP_001284854.1 IG_like 39..133 CDD:214653 20/89 (22%)
IG_like 144..226 CDD:214653 20/97 (21%)
IGc2 152..209 CDD:197706 13/72 (18%)
I-set 230..319 CDD:254352 27/108 (25%)
IGc2 243..309 CDD:197706 19/80 (24%)
IG_like 330..424 CDD:214653 17/102 (17%)
IGc2 339..412 CDD:197706 13/81 (16%)
Ig 447..518 CDD:143165 11/47 (23%)
fn3 534..611 CDD:278470
FN3 640..735 CDD:238020
IL18RAPNP_001380415.1 Ig_6 100..155 CDD:408247 11/60 (18%)
Ig 162..>221 CDD:416386 14/64 (22%)
Ig strand A 162..166 CDD:409353 1/3 (33%)
Ig strand B 171..175 CDD:409353 0/3 (0%)
Ig strand C 188..193 CDD:409353 1/4 (25%)
Ig strand C' 196..198 CDD:409353 0/1 (0%)
Ig strand E 204..209 CDD:409353 1/4 (25%)
Ig 251..354 CDD:416386 25/104 (24%)
Ig strand A 251..254 CDD:409353 1/2 (50%)
Ig strand A' 262..265 CDD:409353 1/2 (50%)
Ig strand B 267..276 CDD:409353 3/8 (38%)
Ig strand C 285..290 CDD:409353 3/6 (50%)
Ig strand D 300..308 CDD:409353 2/7 (29%)
Ig strand E 315..323 CDD:409353 0/7 (0%)
Ig strand F 334..340 CDD:409353 1/5 (20%)
Ig strand G 344..350 CDD:409353 2/5 (40%)
TIR 419..559 CDD:396246 22/111 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.