DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fas2 and IL1R2

DIOPT Version :9

Sequence 1:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster
Sequence 2:XP_011510103.1 Gene:IL1R2 / 7850 HGNCID:5994 Length:441 Species:Homo sapiens


Alignment Length:244 Identity:62/244 - (25%)
Similarity:93/244 - (38%) Gaps:40/244 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 GKPLILTCRPTVP-------EPSLVADLQWKDNRNNTILPKPNGRNQPPMYTETLPGESLALMIT 104
            |:|:.|.| |.||       .|.:  :|.|..|.:...:|   |..:..|:     .:..||.:.
Human    86 GEPVALRC-PQVPYWLWASVSPRI--NLTWHKNDSARTVP---GEEETRMW-----AQDGALWLL 139

  Fly   105 SLSVEMGGKYYCT---ASYANTEILEKGVTIKTYVAITWTNAPENQYPTLGQDYVVMC----EVK 162
            ....|..|.|.||   |||.:...:|..|...|...:.:.:.|  |..||....|::|    |..
Human   140 PALQEDSGTYVCTTRNASYCDKMSIELRVFENTDAFLPFISYP--QILTLSTSGVLVCPDLSEFT 202

  Fly   163 ADPNPT-IDWLRNGDPIRTTNDKY--VVQTNGLLIRNVQESDEGIYTCRAAVIETGELLERTIRV 224
            .|.... |.|.::...:...|:|:  |..|..||:.:|...|.|.|.|.......|:....|..:
Human   203 RDKTDVKIQWYKDSLLLDKDNEKFLSVRGTTHLLVHDVALEDAGYYRCVLTFAHEGQQYNITRSI 267

  Fly   225 EVFIQ-------PEIISLPTNLEAVEGKPFAANC---TARGKPVPEISW 263
            |:.|:       |.|||....:.|..|......|   ...|.|:..:.|
Human   268 ELRIKKKKEETIPVIISPLKTISASLGSRLTIPCKVFLGTGTPLTTMLW 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fas2NP_001284854.1 IG_like 39..133 CDD:214653 26/95 (27%)
IG_like 144..226 CDD:214653 23/88 (26%)
IGc2 152..209 CDD:197706 17/63 (27%)
I-set 230..319 CDD:254352 10/37 (27%)
IGc2 243..309 CDD:197706 5/24 (21%)
IG_like 330..424 CDD:214653
IGc2 339..412 CDD:197706
Ig 447..518 CDD:143165
fn3 534..611 CDD:278470
FN3 640..735 CDD:238020
IL1R2XP_011510103.1 PHA02785 49..370 CDD:165149 62/244 (25%)
Ig1_IL1R_like 73..168 CDD:143233 25/92 (27%)
Ig2_IL1R2_like 179..273 CDD:143305 25/95 (26%)
ig 284..384 CDD:278476 7/33 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.