DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fas2 and BSG

DIOPT Version :10

Sequence 1:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster
Sequence 2:NP_001719.2 Gene:BSG / 682 HGNCID:1116 Length:385 Species:Homo sapiens


Alignment Length:326 Identity:71/326 - (21%)
Similarity:124/326 - (38%) Gaps:72/326 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 ISLPTNLEAVEGKPFAANCTARGKPVPEISWIRD-------ATQL-NVATADRFQVNP-----QT 284
            :..|.:.:...|.....:|.|.|.|||||.|..:       .:|| :.|..||..::.     ..
Human    26 VQAPLSQQRWVGGSVELHCEAVGSPVPEIQWWFEGQGPNDTCSQLWDGARLDRVHIHATYHQHAA 90

  Fly   285 GLVTISSVSQDDYGTYTCLAKN-----------RAGVVDQKTKLNVLVRPQIYELYNVTGARTKE 338
            ..::|.::.::|.|||.|.|.|           |...|..:..:.||....::......|::   
Human    91 STISIDTLVEEDTGTYECRASNDPDRNHLTRAPRVKWVRAQAVVLVLE
PGTVFTTVEDLGSK--- 152

  Fly   339 IAITCRAKGRPAPAITFRRW---GT--QEEYTNGQQDDDPRIILEPNFDEERGESTGTLRISNAE 398
            |.:|| :....|..:|..||   |.  :|:...||:.:     .:.:.|::.||           
Human   153 ILLTC-SLNDSATEVTGHRWLKGGVVLKEDALPGQKTE-----FKVDSDDQWGE----------- 200

  Fly   399 RSDDGLYQCIARNKGADAYKTGHITVEFAPDFSHMKELPPVFSWEQRKANLSCLAMGIPNATIEW 463
                  |.|:..   .:...|.:|.:...|....:|....:.  |...|.|.|.:..:|..| :|
Human   201 ------YSCVFL---PEPMGTANIQLHGPPRVKAVKSSEHIN--EGETAMLVCKSESVPPVT-DW 253

  Fly   464 HWNGRKIKDLYDTNLK--------IVGTGPRSDLIVHPVTRQYYSG-YKCIATNIHGTAEHDMQL 519
            .|  .||.|..|..|.        :..:..||:|.:..:..:...| |:|..|:..|:.:..:.|
Human   254 AW--YKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITL 316

  Fly   520 K 520
            :
Human   317 R 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fas2NP_001284854.1 Ig 33..121 CDD:472250
Ig strand B 50..54 CDD:409353
Ig strand C 66..70 CDD:409353
Ig strand E 99..103 CDD:409353
Ig strand F 113..118 CDD:409353
Ig 139..209 CDD:472250
Ig strand B 156..159 CDD:409353
Ig strand C 168..172 CDD:409353
Ig strand E 190..194 CDD:409353
Ig strand F 204..209 CDD:409353
IgI_4_MYLK-like 229..319 CDD:409568 26/109 (24%)
Ig strand A 229..232 CDD:409568
Ig strand A' 238..241 CDD:409568 0/2 (0%)
Ig strand B 246..254 CDD:409568 1/7 (14%)
Ig strand C 260..264 CDD:409568 2/3 (67%)
Ig strand C' 267..270 CDD:409568 0/2 (0%)
Ig strand D 277..281 CDD:409568 1/3 (33%)
Ig strand E 285..290 CDD:409568 0/4 (0%)
Ig strand F 298..306 CDD:409568 5/7 (71%)
Ig strand G 309..319 CDD:409568 1/9 (11%)
IG_like 330..424 CDD:214653 19/98 (19%)
Ig strand B 339..343 CDD:409353 1/3 (33%)
Ig strand C 352..356 CDD:409353 1/3 (33%)
Ig strand E 388..394 CDD:409353 0/5 (0%)
Ig strand F 404..409 CDD:409353 2/4 (50%)
Ig 447..515 CDD:409353 20/76 (26%)
Ig strand B 447..451 CDD:409353 2/3 (67%)
Ig strand C 460..464 CDD:409353 1/3 (33%)
Ig strand E 487..491 CDD:409353 2/3 (67%)
Ig strand F 501..506 CDD:409353 3/5 (60%)
FN3 525..619 CDD:238020
FN3 640..735 CDD:238020
BSGNP_001719.2 Ig0_BSG1 23..138 CDD:409534 27/111 (24%)
Ig strand A 24..28 CDD:409534 0/1 (0%)
Ig strand A' 29..35 CDD:409534 1/5 (20%)
Ig strand B 38..47 CDD:409534 1/8 (13%)
Ig strand C 52..60 CDD:409534 4/7 (57%)
Ig strand C' 65..69 CDD:409534 0/3 (0%)
Ig strand D 79..85 CDD:409534 0/5 (0%)
Ig strand E 88..97 CDD:409534 1/8 (13%)
Ig strand F 104..112 CDD:409534 5/7 (71%)
Ig strand G 128..138 CDD:409534 2/9 (22%)
Essential for interaction with KDR/VEGFR2. /evidence=ECO:0000269|PubMed:25825981 195..199 1/3 (33%)
IG_like 228..318 CDD:214653 22/95 (23%)
Ig strand B 238..242 CDD:409353 2/3 (67%)
Ig strand E 283..287 CDD:409353 2/3 (67%)
Ig strand F 298..303 CDD:409353 2/4 (50%)
Ig strand G 311..314 CDD:409353 0/2 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 353..385
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.