DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fas2 and ROBO3

DIOPT Version :10

Sequence 1:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster
Sequence 2:NP_071765.2 Gene:ROBO3 / 64221 HGNCID:13433 Length:1386 Species:Homo sapiens


Alignment Length:809 Identity:191/809 - (23%)
Similarity:321/809 - (39%) Gaps:164/809 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 AQSPILEIYPKQEVQRKPVGKPLILTCRPT-VPEPSLVADLQWKDN--RNNTILPKPNGRNQPPM 89
            |...|:|..|...|.|   |:|..|.||.. .|.|    :::|..|  |..|:      |..|..
Human    62 AMPRIVEQPPDLLVSR---GEPATLPCRAEGRPRP----NIEWYKNGARVATV------REDPRA 113

  Fly    90 YTETLPGESLALMITSLSVEMG-------GKYYCTASYANTEILEKGVTIKTYVAI---TWTNAP 144
            :...||..:|...    .:..|       |.|.|.|.........:..:::  ||:   .:..:|
Human   114 HRLLLPSGALFFP----RIVHGRRARPDEGVYTCVARNYLGAAASRNASLE--VAVLRDDFRQSP 172

  Fly   145 ENQYPTLGQDYVVMC-EVKADPNPTIDWLRNGDPIRTTNDKYVVQTNGLLIRNVQESDEGIYTCR 208
            .|....:|:..|:.| ..:..|.|::.|.::|..::....:..::...|::.:..:||.|:|.|.
Human   173 GNVVVAVGEPAVLECVPPRGHPEPSVSWRKDGARLKEEEGRITIRGGKLMMSHTLKSDAGMYVCV 237

  Fly   209 AAVIETGELLERTIRVEVFIQPEIISLPTNLEAVEGKPFAANCTARGKPVPEISWIRDATQLNVA 273
            |:.: .||.......|.|..:|..:..|.|...:...|....|..:|.|.|.:.|.::..:|   
Human   238 ASNM-AGERESAAAEVMVLERPSFLRRPVNQVVLADAPVTFLCEVKGDPPPRLRWRKEDGEL--- 298

  Fly   274 TADRFQVNPQTGLVTISSVSQDDYGTYTCLAKNRAGVVDQKTKLNVLVRPQ-IYELYNVTGARTK 337
            ...|:::.....| .|..||.:|.|||||:|:|..|..:....|:|.|.|| :.:..:...|..:
Human   299 PTGRYEIRSDHSL-WIGHVSAEDEGTYTCVAENSVGRAEASGSLSVHVPPQLVTQPQDQMAAPGE 362

  Fly   338 EIAITCRAKGRPAPAITFRRWGTQEEYTNGQQDDDPRIILEPNFD-EERGEST----GTLRISNA 397
            .:|..|..||.|.|||.:::.|:|             ::|.|:.. :..|..:    |.|.|:..
Human   363 SVAFQCETKGNPPPAIFWQKEGSQ-------------VLLFPSQSLQPTGRFSVSPRGQLNITAV 414

  Fly   398 ERSDDGLYQCIARNKGADAYKTGHITVEFAPDFSHMKELPPVFSWEQRKAN----------LSCL 452
            :|.|.|.|.|.|.:..........:.::.|    .:..||||..  |..||          |.|.
Human   415 QRGDAGYYVCQAVSVAGSILAKALLEIKGA----SLDGLPPVIL--QGPANQTLVLGSSVWLPCR 473

  Fly   453 AMGIPNATIEWHWNGRKIKDLYDTNLKIVGTGPRSDLIVHPVTRQYYSGYKCIATNIHGTAEHDM 517
            ..|.|..::.|..:|:.::. .|...|.:..|   .|.:..|.......|.|:|.:..|.|....
Human   474 VTGNPQPSVRWKKDGQWLQG-DDLQFKTMANG---TLYIANVQEMDMGFYSCVAKSSTGEATWSG 534

  Fly   518 QLKEAR----VPDFVSE-----AKPSQLTAT-------TMTFDIRGPSTELGLPILAYSVQYKEA 566
            .||...    .||..:|     ..|||...|       |:|:.   |:.:.|..:.:|.:   ||
Human   535 WLKMREDWGVSPDPPTEPSSPPGAPSQPVVTEITKNSITLTWK---PNPQTGAAVTSYVI---EA 593

  Fly   567 LNPDWSTAYNRSWSPDS------PYIVEGLRPQTEYSFRFAARNQVGLGNWGVNQQQ--STPRRS 623
            .:|    |...:|...:      .:.|.||:|.|.|.|...|     :|.||:::..  |.|.|:
Human   594 FSP----AAGNTWRTVADGVQLETHTVSGLQPNTIYLFLVRA-----VGAWGLSEPSPVSEPVRT 649

  Fly   624 APEEP-KPLHNPVQHDK---------EEPVVVSPYSDHFELRWGVPADNGEPIDRYQIKYCPGVK 678
            ....| :|:.:|.:..:         :||:|:.|.:  .::.|.|..    |:...|     |.:
Human   650 QDSSPSRPVEDPWRGQQGLAEVAVRLQEPIVLGPRT--LQVSWTVDG----PVQLVQ-----GFR 703

  Fly   679 IS--------GTWTELENSCNTVEVMETTSFEMTQLVG---NTYYRIELKAHNAIGYSSPASIIM 732
            :|        |:||.|:        :::.|.:.|.|.|   .|..:|:::|....|..:.:   :
Human   704 VSWRVAGPEGGSWTMLD--------LQSPSQQSTVLRGLPPGTQIQIKVQAQGQEGLGAES---L 757

  Fly   733 KTTRGIDVIQVAERQVFSSAAIVGIAIGG 761
            ..||.|     .|.........|.:|:||
Human   758 SVTRSI-----PEEAPSGPPQGVAVALGG 781

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fas2NP_001284854.1 Ig 33..121 CDD:472250 25/97 (26%)
Ig strand B 50..54 CDD:409353 1/3 (33%)
Ig strand C 66..70 CDD:409353 0/3 (0%)
Ig strand E 99..103 CDD:409353 1/3 (33%)
Ig strand F 113..118 CDD:409353 2/4 (50%)
Ig 139..209 CDD:472250 15/70 (21%)
Ig strand B 156..159 CDD:409353 1/2 (50%)
Ig strand C 168..172 CDD:409353 0/3 (0%)
Ig strand E 190..194 CDD:409353 1/3 (33%)
Ig strand F 204..209 CDD:409353 2/4 (50%)
IgI_4_MYLK-like 229..319 CDD:409568 25/89 (28%)
Ig strand A 229..232 CDD:409568 1/2 (50%)
Ig strand A' 238..241 CDD:409568 1/2 (50%)
Ig strand B 246..254 CDD:409568 2/7 (29%)
Ig strand C 260..264 CDD:409568 0/3 (0%)
Ig strand C' 267..270 CDD:409568 0/2 (0%)
Ig strand D 277..281 CDD:409568 1/3 (33%)
Ig strand E 285..290 CDD:409568 1/4 (25%)
Ig strand F 298..306 CDD:409568 6/7 (86%)
Ig strand G 309..319 CDD:409568 2/9 (22%)
IG_like 330..424 CDD:214653 23/98 (23%)
Ig strand B 339..343 CDD:409353 1/3 (33%)
Ig strand C 352..356 CDD:409353 2/3 (67%)
Ig strand E 388..394 CDD:409353 2/9 (22%)
Ig strand F 404..409 CDD:409353 2/4 (50%)
Ig 447..515 CDD:409353 18/77 (23%)
Ig strand B 447..451 CDD:409353 3/13 (23%)
Ig strand C 460..464 CDD:409353 0/3 (0%)
Ig strand E 487..491 CDD:409353 1/3 (33%)
Ig strand F 501..506 CDD:409353 2/4 (50%)
FN3 525..619 CDD:238020 28/113 (25%)
FN3 640..735 CDD:238020 22/105 (21%)
ROBO3NP_071765.2 Ig 64..162 CDD:472250 26/116 (22%)
Ig strand B 81..85 CDD:409353 1/3 (33%)
Ig strand C 94..98 CDD:409353 0/3 (0%)
Ig strand E 121..125 CDD:409353 1/3 (33%)
Ig strand F 140..145 CDD:409353 2/4 (50%)
Ig strand G 154..157 CDD:409353 0/2 (0%)
Ig 169..254 CDD:472250 19/85 (22%)
Ig strand B 183..187 CDD:409353 1/3 (33%)
Ig strand C 197..201 CDD:409353 0/3 (0%)
Ig strand E 219..223 CDD:409353 1/3 (33%)
Ig strand F 233..238 CDD:409353 2/4 (50%)
Ig strand G 247..250 CDD:409353 0/2 (0%)
Ig 261..343 CDD:472250 24/85 (28%)
Ig strand B 275..279 CDD:409353 0/3 (0%)
Ig strand C 288..292 CDD:409353 0/3 (0%)
Ig strand E 309..313 CDD:409353 1/4 (25%)
Ig strand F 323..328 CDD:409353 4/4 (100%)
Ig strand G 336..339 CDD:409353 0/2 (0%)
Ig 348..445 CDD:472250 25/113 (22%)
Ig strand B 364..368 CDD:409353 1/3 (33%)
Ig strand C 377..381 CDD:409353 2/3 (67%)
Ig strand E 407..411 CDD:409353 2/3 (67%)
Ig strand F 421..426 CDD:409353 2/4 (50%)
Ig strand G 434..437 CDD:409353 0/2 (0%)
Ig 452..536 CDD:472250 20/89 (22%)
Ig strand B 468..472 CDD:409353 1/3 (33%)
Ig strand C 481..485 CDD:409353 0/3 (0%)
Ig strand E 504..508 CDD:409353 2/6 (33%)
FN3 <518..>809 CDD:442628 71/306 (23%)
Ig strand F 518..523 CDD:409353 2/4 (50%)
Ig strand G 531..534 CDD:409353 0/2 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 541..563 6/21 (29%)
FN3 556..649 CDD:238020 27/107 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 639..662 5/22 (23%)
FN3 770..863 CDD:238020 4/12 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 965..989
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1028..1310
PRK12323 <1126..1325 CDD:481241
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1327..1386
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.