DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fas2 and DIP-delta

DIOPT Version :9

Sequence 1:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster
Sequence 2:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster


Alignment Length:344 Identity:86/344 - (25%)
Similarity:136/344 - (39%) Gaps:67/344 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 FIQPEIISLPTNLEAVEGKPFAANCTARGKPVPEISWIRDATQLNVATADRFQVN---------- 281
            |.||    :| |:....|:.....|........:::||....|: :.|..|..::          
  Fly    46 FAQP----IP-NVTVAVGRDANLPCVVEHLGGYKVAWIHIDRQM-ILTIHRHVISRIPRYSITYT 104

  Fly   282 PQTGLVTISSVSQDDYGTYTCLAKNRAGVVDQKTKLNVLVRPQIYEL----YNVTGARTKEIAIT 342
            ..|.|:.::...|||.|.|.|.. |...::.|...|.|:|.|.|.::    .:|.....:.|.:|
  Fly   105 DNTWLLHVNQAHQDDRGYYMCQV-NTNPMISQVGYLQVVVPPNILDIESTPSSVAVRENQNINMT 168

  Fly   343 CRAKGRPAPAITFRRWGTQEEYTNGQQDDDPRIILEPN-----FDEERGESTGTLRISNAERSDD 402
            |||.|.|||.|.:||            :|...|.:|..     :|.:      .|.::...|::.
  Fly   169 CRADGFPAPKIIWRR------------EDGEEIAVEKKKKVLVYDAD------VLPLTKVSRNEM 215

  Fly   403 GLYQCIARNKGA--DAYKTGHITVEFAPDFSHMKELPPVFSWEQRKANLSCLAMGIPNATIEWHW 465
            |.|.|||.| |.  ...|...:.|||:|......:|  |.:.......:.|.....|.|.|.|.:
  Fly   216 GAYLCIATN-GVPPSVSKRIILDVEFSPMIWVPNQL--VGAPSGTDVTIDCHTEAHPKAIIYWVY 277

  Fly   466 N------GRKIKDLYDTNLKIVGTGPRSDLIVHPVTRQY--YSGYKCIATNIHGTAEHDMQLKEA 522
            |      .:|.|..|..|      ..|:.:.:.....||  :..|:||:.|..|..|..:::.|.
  Fly   278 NSVMVLPSKKYKTDYTEN------SYRAHMKLTIRNLQYGDFGNYRCISKNSLGETEGSIRVYEI 336

  Fly   523 RVPDFVSEAKPSQLTATTM 541
            .:|...|:    |:|.||:
  Fly   337 PLPSTPSK----QVTHTTV 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fas2NP_001284854.1 IG_like 39..133 CDD:214653
IG_like 144..226 CDD:214653
IGc2 152..209 CDD:197706
I-set 230..319 CDD:254352 21/98 (21%)
IGc2 243..309 CDD:197706 16/75 (21%)
IG_like 330..424 CDD:214653 27/100 (27%)
IGc2 339..412 CDD:197706 23/77 (30%)
Ig 447..518 CDD:143165 19/78 (24%)
fn3 534..611 CDD:278470 4/8 (50%)
FN3 640..735 CDD:238020
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 21/94 (22%)
Ig 145..238 CDD:416386 29/111 (26%)
Ig strand A 145..149 CDD:409353 2/3 (67%)
Ig strand A' 154..159 CDD:409353 1/4 (25%)
Ig strand B 165..172 CDD:409353 4/6 (67%)
Ig strand C 178..183 CDD:409353 1/4 (25%)
Ig strand C' 185..187 CDD:409353 1/1 (100%)
Ig strand D 195..199 CDD:409353 0/3 (0%)
Ig strand E 203..209 CDD:409353 1/11 (9%)
Ig strand F 216..223 CDD:409353 4/6 (67%)
Ig strand G 230..238 CDD:409353 1/7 (14%)
Ig 242..333 CDD:416386 22/98 (22%)
Ig strand A' 250..253 CDD:409353 2/4 (50%)
Ig strand B 259..266 CDD:409353 1/6 (17%)
Ig strand C 272..277 CDD:409353 2/4 (50%)
Ig strand C' 281..283 CDD:409353 0/1 (0%)
Ig strand D 289..293 CDD:409353 1/3 (33%)
Ig strand E 295..305 CDD:409353 2/15 (13%)
Ig strand F 314..322 CDD:409353 3/7 (43%)
Ig strand G 325..334 CDD:409353 2/8 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.