DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fas2 and CG34353

DIOPT Version :9

Sequence 1:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster
Sequence 2:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster


Alignment Length:576 Identity:125/576 - (21%)
Similarity:210/576 - (36%) Gaps:127/576 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 LALMITSLSVEMGGKYYCTASYANTEILEKGVTI-----KTYVAITWTNAPENQYPTLGQDYVVM 158
            ||:.:.||..|         |.:...::.|...:     :|:..||            |:..|:.
  Fly    63 LAIAVVSLHFE---------SVSAQSMMTKNEPMFISRSETFKFIT------------GETIVLP 106

  Fly   159 CEVKADPNPTIDWLR-----NGDPIRTTNDKYVVQTNG--LLIRNVQESDEGIYTCRAAVIETGE 216
            |||.......:.|.|     ....::.|.|..|...||  |.||:...:|.|.|.|:.|.::..|
  Fly   107 CEVANTDTYVVAWKRGIAILTAGSVKVTPDPRVRLVNGFNLQIRDALPTDAGDYICQIATMDPRE 171

  Fly   217 LLERTIRVEVFIQPEI--ISLPTNLEAVEGKPFAANCTARGKPVPEISWIRDATQLNVATADRFQ 279
            :   |..||:.:.|.|  ||...:|:..:|......|:|.|.|:|.::|.|   :.|:......:
  Fly   172 I---THTVEILVPPRIHHISTGGHLQVKKGSSVRIECSATGNPMPNVTWSR---KNNILPNGEEK 230

  Fly   280 VNPQTGLVTISSVSQDDYGTYTCLAKNRAG-VVDQKTKLNVLVRPQI-YELYNVTGARTKEIAIT 342
            ::  :.:::|.:|.:...|.|.|.|.||.| ....:..|:||..|:| .|...|......|..:.
  Fly   231 LH--SHVLSIENVDRHKGGVYICTANNRVGQPASSQVVLHVLFSPEISVERPVVFSGEGHEATLV 293

  Fly   343 CRAKGRPAPAITFRRWGTQEEYTNGQQDDDPRIILEPNFDEERGESTGTLRISNAERSDDGLYQC 407
            |...|...|.:.:.:...|.:.|            |.:..|.|| |..||.|......|.|.|.|
  Fly   294 CIVHGETQPEVIWFKDTMQLDTT------------ERHIMETRG-SRHTLIIRKVHPQDFGNYSC 345

  Fly   408 IARNKGADAYKTGHITVEFAPDFSHMKELPPVFSWEQRKANLSCLAMGIPNATIEWHWNGRKIKD 472
            :|.|:...|.||  :.:...|:.:.... ||:..::.| .|:| .|:...:...|:..:.||:..
  Fly   346 VAENQLGKARKT--LQLSGKPNVAVFNS-PPISQYKDR-YNIS-WAVDSHSPIEEYKLSFRKLPQ 405

  Fly   473 LYDTNLKIVGTGPRSDLIVHPVTRQYYSGYKC--IATNIHGTAEHDMQLKEARVPDFVSEAKPSQ 535
            .::.....:.:...|..:....::.|.||...  |.:|:.|.:                      
  Fly   406 GHEVVGNAIDSSSSSSSMSSSSSQMYGSGLHAHRIGSNMGGLS---------------------- 448

  Fly   536 LTATTMTFDIRGPSTELG----------------LPILAYSVQYKEALNPDWSTAYNRSWSPDSP 584
                    .:.|..:..|                ||.:..|..|.:.::                
  Fly   449 --------GLSGSGSYSGYGNVIHWGHNDWRNVVLPAVPVSHHYAQGMS---------------- 489

  Fly   585 YIVEGLRPQTEYSFRFAARNQVGLGNWGVNQQQSTPRRSAPEEPKPLHNPVQHDKE 640
            |:|.||.|...|.....:||:.|..:...:...||.....|.:.....|....|.|
  Fly   490 YMVRGLDPDQHYEATVQSRNRYGWSDLTNSFVFSTSSNDGPVDLSTFLNHGLSDNE 545

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fas2NP_001284854.1 IG_like 39..133 CDD:214653 7/38 (18%)
IG_like 144..226 CDD:214653 23/88 (26%)
IGc2 152..209 CDD:197706 19/63 (30%)
I-set 230..319 CDD:254352 24/91 (26%)
IGc2 243..309 CDD:197706 17/65 (26%)
IG_like 330..424 CDD:214653 24/93 (26%)
IGc2 339..412 CDD:197706 18/72 (25%)
Ig 447..518 CDD:143165 13/72 (18%)
fn3 534..611 CDD:278470 15/92 (16%)
FN3 640..735 CDD:238020 1/1 (100%)
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 24/82 (29%)
Ig 103..177 CDD:143165 21/76 (28%)
IG_like 191..269 CDD:214653 20/82 (24%)
IGc2 198..258 CDD:197706 17/64 (27%)
I-set 273..360 CDD:254352 27/101 (27%)
Ig 290..359 CDD:143165 22/83 (27%)
FN3 <466..524 CDD:238020 13/73 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.