DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fas2 and cntn4

DIOPT Version :10

Sequence 1:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster
Sequence 2:NP_001073520.1 Gene:cntn4 / 571349 ZFINID:ZDB-GENE-060929-776 Length:1028 Species:Danio rerio


Alignment Length:951 Identity:203/951 - (21%)
Similarity:328/951 - (34%) Gaps:296/951 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LCSCSLIELTRAQSPILEIYPKQEVQRKPVGKPLILTCRPTVPEPSLVADLQWKDNRNNTILPKP 81
            |...:|..|..::.|...:.|...:::   .:.::.:|......|..   .:||.| .:.:.|||
Zfish    17 LAGNALQNLVFSKQPGSIVSPVDSMEK---SREVVFSCEAQGDPPPF---YRWKLN-GSVVNPKP 74

  Fly    82 NGRNQPPMYTETLPGESLALMITSLSVEM-GGKYYCTASYANTEILEKGVTIK-TYVAITWTNAP 144
            ...:       :|.|.:  |.|..|:.:| .|.|.|.||.:...|:.:..::. .|:....|:..
Zfish    75 GSHH-------SLTGGN--LRINHLNKDMDAGTYQCLASNSFGTIVSREASLTFAYLENFKTHKR 130

  Fly   145 ENQYPTLGQDYVVMCEVKADPNP-----TIDWLRNGDP--IRTTNDKYVVQ-TNGLLIRNVQESD 201
            .:.....||..|::|    .|.|     |..|:.|..|  ::..:.::|.| |..|.|..|:.||
Zfish   131 SSVSVREGQGVVLLC----GPPPHSGALTFSWIFNEYPSIVKQDSRRFVSQETGNLYIAKVEPSD 191

  Fly   202 EGIYTC--RAAVIET------GELLERTIRVEVFIQPEI-ISLPTNLEAVEGKPFAANCTARGKP 257
            .|.|||  ...|.:|      ..|:.||..|....:|:| :..|..::..:|......|.|.|.|
Zfish   192 VGNYTCVVTNTVTKTQVQGPPTPLILRTDGVMGEYEPKIEVQFPEVVQVAKGSTVRLECFALGNP 256

  Fly   258 VPEISWIR-DATQLNVATADRFQVNPQTGLVTISSVSQDDYGTYTCLAKNRAGVVDQKTKLNVLV 321
            ||.|||.| |    .|..|.:..|...:|::.|....|:|.|||.|:|:|..|....:.||:...
Zfish   257 VPSISWRRVD----GVPFARKVDVRKTSGVMEIPYFQQEDAGTYECVAENSKGRNSVQGKLSFFA 317

  Fly   322 RPQIYEL-YNVTGARTKEIAITCRAKGRPAPAITFRRWGTQEEYTNGQQDDDPRIILEPNFDEER 385
            .||:.|. .:|.......:...|:|.|:|.|:.   ||     ..||:.       |||.  |||
Zfish   318 SPQLIEKPQDVQKPIDDSLVWECKATGKPKPSY---RW-----MKNGEN-------LEPT--EER 365

  Fly   386 GE-STGTLRISNAERSDDGLYQCIARNKGADAYKTGHI-TVEFAPDFSHMKELPPVFSWEQRKAN 448
            .: ..|.|.|::...||.|:|||:|.||..:.|....: .:..|||||..:........|.....
Zfish   366 VQVINGALSITHLALSDIGMYQCVAGNKYGEVYSNAELRVIAVAPDFSQNQLKSHTLVKEGGDVL 430

  Fly   449 LSCLAMGIPNATIEWHWNGRKIKDLYDTNLKIVGTGPRSDLIVHPVTRQYYSGYKCIATNIHGTA 513
            :.|.....|..:|.|......:::  .:.:.::.:|   .|.:..|::.....|.|:|.|..|.|
Zfish   431 IECKPKMSPRGSISWRKGNDALRE--SSRIAVLESG---SLRISNVSKSDAGSYTCVARNQFGEA 490

  Fly   514 ----------------------------------------------------------------- 513
                                                                             
Zfish   491 SSLGNLLVKEPTIITTAPNTLDVTVGESIILPCQVSYDPSLELKFTWFFNEQLIHFGSHGGYFEK 555

  Fly   514 ---EH--------DMQLKEAR---------------VPDFVSEAKP--------SQLTATTMTFD 544
               :|        ::||:.|.               ..|.:....|        .::|.||.|..
Zfish   556 VGGQHSAGDIMIRNIQLRHAGKYTCAVQTKVDSSSIATDLIVRGPPGPPTSIHVEEITDTTATLS 620

  Fly   545 IRGPSTELGLPILAYSVQYKEALNPDWSTAYNRSWSPDS--PYIVEG---------LRPQTEYSF 598
            .| |..:...||.||::|.:        |.::..|...|  |.:|.|         |.|..||.|
Zfish   621 WR-PGPDNHSPITAYTIQAR--------TPFSLGWQAVSTVPEVVGGSHLTATVIELNPWVEYEF 676

  Fly   599 RFAARNQVGLGNWGVNQQQSTPRRSA-------------------------------PEE----- 627
            |..|.|.||.|      :.|.|.:.|                               |||     
Zfish   677 RVLASNAVGTG------EPSKPSKKARTKDTVPKVTPANVSGGGGSRSELVITWEPVPEELQNGA 735

  Fly   628 ---------------------PKPLHNPVQHDKEEPVVVSPYSDHFELRWGVPADNGE----PI- 666
                                 |.|..:......|..:..||    |:::.|...:.||    |: 
Zfish   736 GFGYVVAFRPFGSTGWMQAAVPSPEASKYVFKNETILPFSP----FQVKVGAYNNKGEGPFGPVI 796

  Fly   667 -------------DRYQIKYCPGVKISGTW----------------------TELENSCNTVEVM 696
                         .|.:.|......:..:|                      .|.|::.:.:..:
Zfish   797 TIYSAEEEPGRAPSRLRAKSLSASDVEVSWKALPWSTSKKRVLGYELRYWEKNEKEDASSVLRTV 861

  Fly   697 ETTSFEMTQ-LVGNTYYRIELKAHNAIGYSSPASIIMKTTR 736
            ...:..:.| |.|::.|.|.::|:|..|...|:.::..||:
Zfish   862 GNRTLAIIQGLKGSSTYYITVRAYNTAGTGPPSPVVNITTK 902

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fas2NP_001284854.1 Ig 33..121 CDD:472250 20/88 (23%)
Ig strand B 50..54 CDD:409353 0/3 (0%)
Ig strand C 66..70 CDD:409353 0/3 (0%)
Ig strand E 99..103 CDD:409353 1/3 (33%)
Ig strand F 113..118 CDD:409353 2/4 (50%)
Ig 139..209 CDD:472250 23/79 (29%)
Ig strand B 156..159 CDD:409353 1/2 (50%)
Ig strand C 168..172 CDD:409353 1/3 (33%)
Ig strand E 190..194 CDD:409353 1/3 (33%)
Ig strand F 204..209 CDD:409353 3/6 (50%)
IgI_4_MYLK-like 229..319 CDD:409568 31/91 (34%)
Ig strand A 229..232 CDD:409568 1/2 (50%)
Ig strand A' 238..241 CDD:409568 0/2 (0%)
Ig strand B 246..254 CDD:409568 1/7 (14%)
Ig strand C 260..264 CDD:409568 2/3 (67%)
Ig strand C' 267..270 CDD:409568 0/2 (0%)
Ig strand D 277..281 CDD:409568 0/3 (0%)
Ig strand E 285..290 CDD:409568 1/4 (25%)
Ig strand F 298..306 CDD:409568 5/7 (71%)
Ig strand G 309..319 CDD:409568 3/9 (33%)
IG_like 330..424 CDD:214653 29/95 (31%)
Ig strand B 339..343 CDD:409353 0/3 (0%)
Ig strand C 352..356 CDD:409353 0/3 (0%)
Ig strand E 388..394 CDD:409353 2/5 (40%)
Ig strand F 404..409 CDD:409353 3/4 (75%)
Ig 447..515 CDD:409353 13/135 (10%)
Ig strand B 447..451 CDD:409353 0/3 (0%)
Ig strand C 460..464 CDD:409353 1/3 (33%)
Ig strand E 487..491 CDD:409353 1/3 (33%)
Ig strand F 501..506 CDD:409353 2/4 (50%)
FN3 525..619 CDD:238020 30/112 (27%)
FN3 640..735 CDD:238020 22/135 (16%)
cntn4NP_001073520.1 Ig 26..121 CDD:472250 22/110 (20%)
Ig strand B 47..51 CDD:409353 0/3 (0%)
Ig strand C 60..64 CDD:409353 0/6 (0%)
Ig strand E 83..87 CDD:409353 1/5 (20%)
Ig strand F 98..103 CDD:409353 2/4 (50%)
Ig strand G 112..115 CDD:409353 0/2 (0%)
Ig 129..216 CDD:472250 24/90 (27%)
Ig strand B 141..145 CDD:409353 1/3 (33%)
Ig strand C 155..159 CDD:409353 1/3 (33%)
Ig strand E 180..184 CDD:409353 1/3 (33%)
Ig strand F 194..199 CDD:409353 3/4 (75%)
Ig strand G 210..213 CDD:409353 0/2 (0%)
Ig 228..316 CDD:472250 31/91 (34%)
Ig strand B 246..250 CDD:409353 0/3 (0%)
Ig strand C 259..263 CDD:409353 2/3 (67%)
Ig strand E 281..285 CDD:409353 1/3 (33%)
Ig strand F 295..300 CDD:409353 3/4 (75%)
Ig strand G 308..311 CDD:409353 0/2 (0%)
Ig 320..405 CDD:472250 31/101 (31%)
Ig strand B 336..340 CDD:143205 0/3 (0%)
Ig strand C 349..353 CDD:143205 2/11 (18%)
Ig strand E 371..375 CDD:143205 2/3 (67%)
Ig strand F 385..390 CDD:143205 3/4 (75%)
Ig strand G 398..401 CDD:143205 1/2 (50%)
Ig 410..498 CDD:472250 18/92 (20%)
Ig strand B 429..433 CDD:409353 0/3 (0%)
Ig strand C 442..446 CDD:409353 1/3 (33%)
Ig strand E 464..468 CDD:409353 2/6 (33%)
Ig strand F 478..483 CDD:409353 2/4 (50%)
Ig strand G 491..494 CDD:409353 0/2 (0%)
Ig 500..601 CDD:472250 5/100 (5%)
Ig strand B 519..523 CDD:409353 0/3 (0%)
Ig strand C 534..538 CDD:409353 0/3 (0%)
Ig strand E 563..567 CDD:409353 0/3 (0%)
Ig strand F 577..582 CDD:409353 0/4 (0%)
Ig strand G 590..593 CDD:409353 0/2 (0%)
FN3 601..693 CDD:238020 30/106 (28%)
FN3 707..799 CDD:238020 13/95 (14%)
FN3 808..901 CDD:238020 14/92 (15%)
FN3 893..994 CDD:238020 3/10 (30%)

Return to query results.
Submit another query.