DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fas2 and il1rapl1a

DIOPT Version :9

Sequence 1:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster
Sequence 2:XP_021334418.1 Gene:il1rapl1a / 568868 ZFINID:ZDB-GENE-061013-249 Length:1520 Species:Danio rerio


Alignment Length:311 Identity:60/311 - (19%)
Similarity:92/311 - (29%) Gaps:114/311 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   474 YDTNLKIVGT----------GPRSDLI---------VHPVTRQYYSGYKCIATNIHGTAEHDMQ- 518
            ||..::...|          |.|.|||         :|.:...  :.|..||:......:.|:| 
Zfish   109 YDLEIQFFDTRCVAPCLVVPGQRDDLILGSNIIKHLIHELKNN--NDYWDIASRPDNKFDEDVQQ 171

  Fly   519 ----------LKEARVPDFVSEAKPSQLTATTMTFDIRGPSTELGLPILAYSVQYKEALNPDWS- 572
                      .|...|||.:...|.:|....              ||...:.|         |. 
Zfish   172 FLSMFTGVERWKGDTVPDKIGTVKLTQAVVL--------------LPKHEHLV---------WGR 213

  Fly   573 TAYNRSWSPDSPYIVEGLRPQTEYSFRFAARNQVGLGNWG-----------VNQQQSTPRRSAPE 626
            ...|...||.|..|||....:.........|..|.|  ||           .|:..:..|.|...
Zfish   214 LPSNVPMSPGSTVIVEPTNSKAMPRDILVGRLVVPL--WGDRWVPMTVMNPTNKVITLKRNSKMA 276

  Fly   627 EPKP------------LHNPVQHDKEEPVVVSPYSDHFE---LRWGVPADNGEPIDRYQIKYCPG 676
            :..|            ||..:..:|.:....|..:||.:   |..|:     |.||         
Zfish   277 DVFPCIASEDFEIFQGLHITLVENKSDDSCNSCAADHIDKNLLNLGL-----EEID--------- 327

  Fly   677 VKISGTWTELENSCNTVEVMETTSFEMTQLVG---NTYYRIELKAHNAIGY 724
                ..|:::.:.|.:         ::|||:.   :.:.:..|....|.||
Zfish   328 ----VNWSQISDDCKS---------QLTQLLADYQDIFSKHPLDCGEATGY 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fas2NP_001284854.1 IG_like 39..133 CDD:214653
IG_like 144..226 CDD:214653
IGc2 152..209 CDD:197706
I-set 230..319 CDD:254352
IGc2 243..309 CDD:197706
IG_like 330..424 CDD:214653
IGc2 339..412 CDD:197706
Ig 447..518 CDD:143165 13/62 (21%)
fn3 534..611 CDD:278470 15/77 (19%)
FN3 640..735 CDD:238020 17/91 (19%)
il1rapl1aXP_021334418.1 retropepsin_like 46..137 CDD:133136 8/27 (30%)
RT_LTR 403..579 CDD:238825
RNase_HI_RT_Ty3 701..823 CDD:260006
rve 1068..1176 CDD:307008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.