DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fas2 and hmcn2

DIOPT Version :10

Sequence 1:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster
Sequence 2:XP_001920501.5 Gene:hmcn2 / 565032 ZFINID:ZDB-GENE-030131-9765 Length:4212 Species:Danio rerio


Alignment Length:933 Identity:225/933 - (24%)
Similarity:365/933 - (39%) Gaps:185/933 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 QSPILEIY----------PKQEVQRKPVGKPLILTCRPT-VPEPSLVADLQWKDNRNNTILPKPN 82
            :|.:|.||          .:.||:...||..|||.|... :|:|    ::.|  .||...|...|
Zfish  2011 KSILLTIYALPALVPRLESESEVRTPLVGSTLILRCEANGIPKP----EVTW--YRNGLQLAAGN 2069

  Fly    83 GRNQPPMYTETLPGESLALMITSLSVEMGGKYYCTASYANTEILEKGVTIKTYVAITWTNAPENQ 147
            |          |..|...|.|..:.|..||.|.|..|..      .|...:|: .:|....|..:
Zfish  2070 G----------LRIERQQLEIVGVQVADGGVYTCKVSNI------AGQVDRTF-RVTVHVPPVME 2117

  Fly   148 YP-------TLGQDYVVMCEVKADPNPTIDWLRNGDPIRTTND-KYVVQTNGLLIRNVQESDEGI 204
            .|       .||....::||....|.|.|.||::|.||.::.. .:..:.|.|.:..:|.|..|.
Zfish  2118 GPLHETLTQNLGSHITLICEASGIPVPNIAWLKDGSPIESSLQWNWSTRANRLELGPLQLSHAGT 2182

  Fly   205 YTCRAAVIETGELLERTIRVEVFIQPEIISL--PTNLEAVEGKPFAANCTARGKPVPEISWIRDA 267
            |||.|...| |: .::...:.::..|.||..  |:.:.|..|:..|..|.|.|.|.|::||:|:.
Zfish  2183 YTCIAKNTE-GQ-TQKDYSLTIYAPPSIIDSGHPSEVSAPVGEELALECRAMGSPAPKVSWLRNG 2245

  Fly   268 TQLNVATADRFQVNPQTGLVTISSVSQDDYGTYTCLAKNRAGVVDQKTK---LNVLVRPQI---- 325
            ..|.....:...::|....:|..||..:|.|||||||.:.||   |:||   |..||.|.|    
Zfish  2246 KTLVNGNTEHINISPDGSTLTFLSVKPEDSGTYTCLAVSSAG---QETKIYTLFALVPPSISGET 2307

  Fly   326 ---YELYNVTGARTKEIAITCRAKGRPAPAITFRRWGTQEEYTNGQQDDDPRIILEPNFDEERGE 387
               .|::.   .:...:.:.|:|||.|.|.|::.|            |..| ::|.|.......:
Zfish  2308 SVPREVHT---TQHSVVTLECKAKGTPQPQISWLR------------DGHP-LLLSPRIRLLSAD 2356

  Fly   388 STGTLRISNAERSDDGLYQCIARNKGADAYKTGHITVEFAPDFSHMKELPPVFSWEQRKANLSCL 452
            |  |||||....||.|:|.|:||::...|.....:.|:..|.....:....|...:.....|:|.
Zfish  2357 S--TLRISPVHLSDSGIYTCVARSRAGLAELNFDLQVQAPPAVERTEPTEQVAVVQGSSVTLTCE 2419

  Fly   453 AMGIPNATIEWHWNGRKIK-------DLYDTNLKIVGTGPRSDLIVHPVTRQYYSG-YKCIATNI 509
            |.|:|..|:.|..:|:.:.       |..:|...:...|| ||           :| |.|:|:|.
Zfish  2420 ARGVPPPTLSWLKDGQPLSLHRNLLLDGQETRFLLSDVGP-SD-----------AGLYSCVASNQ 2472

  Fly   510 HGTAEHDMQLKEARVPDFVSEAKP-SQLTATTMTFDIRGPSTELGLPILAYSVQYKEALNPDWST 573
            .|::.....|.....|.......| .||.|.....::...:|.|..|.|                
Zfish  2473 AGSSTKTFNLTVLEPPKITGSLSPEEQLIAVDSLLELECIATGLPPPTL---------------- 2521

  Fly   574 AYNRSWSPDSPYIVEGL-------------RPQTEYSFRFAARNQVGLGNWGVN---QQQSTPRR 622
                ||..|...|.:.:             :.|.|.:..:........|..|.|   :.|..|..
Zfish  2522 ----SWLKDGRPIQDNMAIIERDGQLLRINKVQVEDAGLYTCLASSPAGEDGRNHWVRVQLPPTL 2582

  Fly   623 SAPEEPKPLHNPV--------QHDKEEPVVVSPYSDHFELRWGVPADNGEPIDRYQIKYCPGVKI 679
            ....:.:.:..|.        |.|.:.|..:..|.|:.:::.|         .|.|      ...
Zfish  2583 LGSNDIRTVSVPAKGHLTLECQTDSDPPPEIEWYKDNVKVQLG---------GRIQ------SIA 2632

  Fly   680 SGTWTELENSCNTVEVMETTSFE--MTQLVGNT--YYRIELKAHNAIGYSSPASIIMKTTRGIDV 740
            ||.:.|:::    |.:.::..:.  :|.:.|:|  ::.:|:.....|...|  |:|:... |.|.
Zfish  2633 SGQFLEIQD----VRMHDSGQYSCVVTNIAGSTSLFFTVEILLPPVIREGS--SLIIAHV-GQDA 2690

  Fly   741 IQVAERQVFSSAAIVGIAIGGVLLL------LFVVDLLCCITVHMG-VMATMCRKAKRSPSE--- 795
            :...|.:...|::::....||.:.|      |.....|...||.:. |....|..:.::.|:   
Zfish  2691 VLPCEVEGAPSSSVMWRKDGGPVPLHNNRFTLLSEGSLRISTVQLSDVGRYYCSVSNQAGSDHRG 2755

  Fly   796 IDDEAKLG-SLYGWRFPLPYCSGQ-LVKEPPPSPLPLPP-PVKLGGSPMSTPLDEKEPLR-TPTG 856
            :|.:..:| |:....|.:...:|| .|.....:.:|.|. ..:..|||:|  :|:....| ..:|
Zfish  2756 MDLKVYVGPSISPGPFNVTVVTGQRAVLSCESTGIPAPQVSWRRNGSPIS--VDQSSAYRLMSSG 2818

  Fly   857 SIKQNS-TIEFDGRFVHSRSGEI 878
            |:...| |.|.:|.|..:.:.|:
Zfish  2819 SLVITSPTAEDEGYFECTVTNEV 2841

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fas2NP_001284854.1 Ig 33..121 CDD:472250 29/98 (30%)
Ig strand B 50..54 CDD:409353 3/3 (100%)
Ig strand C 66..70 CDD:409353 0/3 (0%)
Ig strand E 99..103 CDD:409353 1/3 (33%)
Ig strand F 113..118 CDD:409353 2/4 (50%)
Ig 139..209 CDD:472250 23/77 (30%)
Ig strand B 156..159 CDD:409353 0/2 (0%)
Ig strand C 168..172 CDD:409353 1/3 (33%)
Ig strand E 190..194 CDD:409353 2/3 (67%)
Ig strand F 204..209 CDD:409353 3/4 (75%)
IgI_4_MYLK-like 229..319 CDD:409568 34/94 (36%)
Ig strand A 229..232 CDD:409568 1/2 (50%)
Ig strand A' 238..241 CDD:409568 0/2 (0%)
Ig strand B 246..254 CDD:409568 2/7 (29%)
Ig strand C 260..264 CDD:409568 1/3 (33%)
Ig strand C' 267..270 CDD:409568 0/2 (0%)
Ig strand D 277..281 CDD:409568 0/3 (0%)
Ig strand E 285..290 CDD:409568 1/4 (25%)
Ig strand F 298..306 CDD:409568 7/7 (100%)
Ig strand G 309..319 CDD:409568 5/12 (42%)
IG_like 330..424 CDD:214653 26/93 (28%)
Ig strand B 339..343 CDD:409353 0/3 (0%)
Ig strand C 352..356 CDD:409353 1/3 (33%)
Ig strand E 388..394 CDD:409353 3/5 (60%)
Ig strand F 404..409 CDD:409353 2/4 (50%)
Ig 447..515 CDD:409353 20/75 (27%)
Ig strand B 447..451 CDD:409353 1/3 (33%)
Ig strand C 460..464 CDD:409353 1/3 (33%)
Ig strand E 487..491 CDD:409353 2/3 (67%)
Ig strand F 501..506 CDD:409353 3/5 (60%)
FN3 525..619 CDD:238020 19/110 (17%)
FN3 640..735 CDD:238020 18/98 (18%)
hmcn2XP_001920501.5 Ig strand F 1221..1226 CDD:409570
Ig strand G 1234..1237 CDD:409570
Ig 1245..1335 CDD:472250
Ig strand B 1263..1267 CDD:409570
Ig strand C 1276..1280 CDD:409570
Ig strand E 1301..1305 CDD:409570
Ig strand F 1315..1320 CDD:409570
Ig strand G 1328..1331 CDD:409570
Ig 1338..1430 CDD:472250
Ig strand B 1358..1362 CDD:409353
Ig strand C 1371..1375 CDD:409353
Ig strand E 1394..1398 CDD:409353
Ig strand F 1408..1413 CDD:409353
Ig strand G 1421..1424 CDD:409353
I-set 1443..1523 CDD:400151
Ig strand B 1451..1455 CDD:409353
Ig strand C 1464..1468 CDD:409353
Ig strand E 1488..1493 CDD:409353
Ig strand F 1503..1508 CDD:409353
I-set 1538..1608 CDD:400151
Ig strand B 1546..1550 CDD:409353
Ig strand C 1559..1563 CDD:409353
Ig strand E 1582..1586 CDD:409353
Ig strand F 1596..1601 CDD:409353
Ig strand G 1610..1613 CDD:409353
ChlD <21..206 CDD:440853
IG_like 441..512 CDD:214653
Ig 516..603 CDD:472250
Ig strand B 533..537 CDD:409353
Ig strand C 546..550 CDD:409353
Ig strand E 569..573 CDD:409353
Ig strand F 583..588 CDD:409353
Ig strand G 596..599 CDD:409353
Ig_3 607..680 CDD:464046
I-set 711..784 CDD:400151
Ig strand B 714..718 CDD:409353
Ig strand C 727..731 CDD:409353
Ig strand E 750..754 CDD:409353
Ig strand F 764..769 CDD:409353
Ig strand G 777..780 CDD:409353
IG_like 794..879 CDD:214653
Ig strand B 805..809 CDD:409353
Ig strand C 818..822 CDD:409353
Ig strand E 845..849 CDD:409353
Ig strand F 859..864 CDD:409353
Ig strand G 872..875 CDD:409353
Ig 885..972 CDD:472250
Ig strand C 916..920 CDD:409353
Ig strand E 938..942 CDD:409353
Ig strand F 952..957 CDD:409353
Ig strand G 965..968 CDD:409353
Ig_3 975..1049 CDD:464046
IG_like 1083..1159 CDD:214653
Ig strand B 1089..1093 CDD:409353
Ig strand C 1102..1106 CDD:409353
Ig strand E 1125..1129 CDD:409353
Ig strand F 1139..1144 CDD:409353
Ig strand G 1152..1155 CDD:409353
I-set 1163..1241 CDD:400151
Ig strand B 1180..1184 CDD:409570
Ig strand C 1193..1197 CDD:409570
Ig strand E 1208..1211 CDD:409570
Ig 1637..1714 CDD:472250
Ig strand B 1644..1648 CDD:409353
Ig strand C 1657..1661 CDD:409353
Ig strand E 1680..1684 CDD:409353
Ig strand F 1694..1699 CDD:409353
IG_like 1753..1830 CDD:214653
Ig strand B 1760..1764 CDD:409353
Ig strand C 1773..1777 CDD:409353
Ig strand E 1796..1800 CDD:409353
Ig strand F 1810..1815 CDD:409353
Ig strand G 1823..1826 CDD:409353
I-set 1834..1918 CDD:400151
Ig strand B 1855..1859 CDD:409256
Ig strand C 1868..1872 CDD:409256
Ig strand E 1891..1895 CDD:409256
Ig strand F 1905..1910 CDD:409256
Ig strand G 1918..1921 CDD:409256
Ig 1939..2017 CDD:472250 2/5 (40%)
Ig strand B 1947..1951 CDD:409256
Ig strand C 1960..1964 CDD:409256
Ig strand E 1983..1987 CDD:409256
Ig strand F 1997..2002 CDD:409256
Ig strand G 2010..2013 CDD:409256 0/1 (0%)
I-set 2038..2110 CDD:400151 26/94 (28%)
Ig strand B 2042..2046 CDD:409353 3/3 (100%)
Ig strand C 2055..2059 CDD:409353 1/5 (20%)
Ig strand F 2090..2095 CDD:409353 2/4 (50%)
Ig_3 2113..2189 CDD:464046 23/75 (31%)
Ig_3 2205..2282 CDD:464046 26/76 (34%)
I-set 2307..2391 CDD:400151 27/101 (27%)
Ig strand B 2321..2325 CDD:409353 0/3 (0%)
Ig strand C 2334..2338 CDD:409353 1/3 (33%)
Ig strand E 2357..2361 CDD:409353 3/5 (60%)
Ig strand F 2371..2376 CDD:409353 2/4 (50%)
I-set 2400..2484 CDD:400151 22/95 (23%)
Ig strand B 2414..2418 CDD:409353 1/3 (33%)
Ig strand C 2427..2431 CDD:409353 1/3 (33%)
Ig strand E 2447..2454 CDD:409353 1/6 (17%)
Ig strand F 2464..2469 CDD:409353 2/4 (50%)
Ig_3 2487..2562 CDD:464046 15/94 (16%)
Ig 2599..2667 CDD:472250 15/86 (17%)
Ig strand B 2599..2603 CDD:409353 0/3 (0%)
Ig strand C 2612..2616 CDD:409353 0/3 (0%)
Ig strand E 2635..2639 CDD:409353 0/3 (0%)
Ig strand F 2649..2654 CDD:409353 0/4 (0%)
IG_like 2679..2760 CDD:214653 18/83 (22%)
Ig strand B 2690..2694 CDD:409353 0/3 (0%)
Ig strand C 2703..2707 CDD:409353 0/3 (0%)
Ig strand E 2726..2730 CDD:409353 1/3 (33%)
Ig strand F 2740..2745 CDD:409353 1/4 (25%)
Ig_3 2764..2839 CDD:464046 20/76 (26%)
Ig 2857..2943 CDD:472250
Ig strand B 2873..2877 CDD:409353
Ig strand C 2886..2890 CDD:409353
Ig strand E 2909..2913 CDD:409353
Ig strand F 2923..2928 CDD:409353
Ig strand G 2936..2939 CDD:409353
Ig_3 2946..3020 CDD:464046
Ig_3 3036..3110 CDD:464046
IG_like 3133..3214 CDD:214653
Ig strand B 3144..3148 CDD:409353
Ig strand C 3157..3161 CDD:409353
Ig strand E 3180..3184 CDD:409353
Ig strand F 3194..3199 CDD:409353
Ig strand G 3207..3210 CDD:409353
Ig 3218..3293 CDD:472250
Ig strand B 3235..3239 CDD:409353
Ig strand C 3248..3252 CDD:409353
Ig strand E 3269..3273 CDD:409353
Ig strand F 3283..3288 CDD:409353
I-set 3316..3394 CDD:400151
Ig strand B 3325..3329 CDD:409353
Ig strand C 3338..3342 CDD:409353
Ig strand E 3360..3364 CDD:409353
Ig strand F 3374..3379 CDD:409353
Ig strand G 3387..3390 CDD:409353
TSP1 3401..3452 CDD:214559
G2F 3454..3636 CDD:462175
EGF_CA 3691..3721 CDD:214542
EGF_CA 3731..3775 CDD:214542
EGF_CA 3776..3814 CDD:214542
EGF_CA 3816..3849 CDD:238011
EGF_CA 3858..3889 CDD:429571
EGF_CA 3901..3940 CDD:214542
EGF_CA 4005..4044 CDD:214542
EGF_CA 4045..4085 CDD:214542
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.