DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fas2 and vsig8b

DIOPT Version :9

Sequence 1:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster
Sequence 2:NP_001124253.1 Gene:vsig8b / 564423 ZFINID:ZDB-GENE-081104-51 Length:363 Species:Danio rerio


Alignment Length:210 Identity:48/210 - (22%)
Similarity:76/210 - (36%) Gaps:54/210 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 PTNLEAVEGKPFAANCTARGKPVP----EISWI---RDAT-------------QLNVATAD---- 276
            |..::..:|:.....||.....:.    :|.|.   :|.|             |..:.:.|    
Zfish    32 PQTIKKAQGEVLTLGCTYTLAAIDVGDLDIEWTIVSQDMTQKDQLILSYTGGKQYQLGSPDLMSR 96

  Fly   277 -RFQVNPQTG--LVTISSVSQDDYGTYTCLAKNRAGVVDQKTKLNVLVRPQIYELYNVTGARTK- 337
             :|..:|..|  .|.::::...|..||.|..|...|:..:|..|.|||||...:.: |.|:..| 
Zfish    97 FKFVADPSRGDATVNMTNLKAPDTATYQCKVKKTPGIDTRKITLVVL
VRPSRPKCW-VDGSEEKG 160

  Fly   338 -EIAITCRAKGRPAPAITFRRWGTQEEYT----NGQQDDDPRIILEPNFDEERGESTGTLRISNA 397
             .:::.|.:....:|.          :||    .||        |.|.  ..:...||.|.|.|.
Zfish   161 GTVSLRCTSSQGSSPL----------KYTWTKETGQ--------LPPT--STQNSQTGELLIRNH 205

  Fly   398 ERSDDGLYQCIARNK 412
            ..|..|.|.|...|:
Zfish   206 SESYTGNYFCEVSNE 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fas2NP_001284854.1 IG_like 39..133 CDD:214653
IG_like 144..226 CDD:214653
IGc2 152..209 CDD:197706
I-set 230..319 CDD:254352 22/109 (20%)
IGc2 243..309 CDD:197706 18/92 (20%)
IG_like 330..424 CDD:214653 21/89 (24%)
IGc2 339..412 CDD:197706 17/76 (22%)
Ig 447..518 CDD:143165
fn3 534..611 CDD:278470
FN3 640..735 CDD:238020
vsig8bNP_001124253.1 V-set 30..143 CDD:311561 22/110 (20%)
IG_like 160..231 CDD:214653 18/81 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.