DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fas2 and robo4

DIOPT Version :10

Sequence 1:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster
Sequence 2:XP_689255.3 Gene:robo4 / 560765 ZFINID:ZDB-GENE-020809-1 Length:1134 Species:Danio rerio


Alignment Length:811 Identity:173/811 - (21%)
Similarity:279/811 - (34%) Gaps:238/811 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 PENQYPTLGQDYVVMCEVKADPNPTIDWLRNGDPIRTTNDKYVVQTNGLLIRNVQ---------- 198
            |.:....:|....:.|..:.:|.|||.|||||.|:.|  ||...|:..:::.:..          
Zfish    77 PSDVVVRVGSPATLSCRAEGNPEPTIQWLRNGQPLDT--DKMDAQSQPIVLPDGSLFFFSVVPGR 139

  Fly   199 --ESDEGIYTCRA------AVIETGELLERTIRVEVFIQPEIISLPTNLEAVEGKPFAANCTAR- 254
              :|.|.:|.|.|      |......|....:|.:..:|      |:::|...|:....||:.. 
Zfish   140 KGQSHEAVYACIAHNSIGNATSRNASLHIAALREDFRVQ------PSDVEVAIGEMATINCSPPV 198

  Fly   255 GKPVPEISWIRDATQLNVATADRFQVNPQTGLVTISSVSQDDYGTYTCLAKNRAGVVDQK-TKLN 318
            |.|.|.::|.:|...:|.:.....::.   |.:.|:...::|.|.|:|:|.|..||.:.: .:|:
Zfish   199 GHPEPNVTWRKDGILINSSNEHYTELK---GKLIIAPAQKNDSGVYSCIASNMIGVRESRAARLS 260

  Fly   319 VLVRPQIYELYNVTGARTKEIA-ITCRAKGRPAPAITFRRWGTQEEYTNGQQDDDPRIILEPNFD 382
            ||.:|.:.........:..|.| ..|.|.|.|.|:|.:.|  .|....||      |.::.|:. 
Zfish   261 VLAKPVLLRKPEDVSVQLGESAQFFCEADGDPMPSIEWSR--EQGPLPNG------RYLINPDH- 316

  Fly   383 EERGESTGTLRISNAERSDDGLYQCIARNKGADAYKTGHITVEFAPDFSHMKELPPVFSWEQRKA 447
                    :|:|......|.|.|.|...||...:..:..:.||.|.. :.:::|         ..
Zfish   317 --------SLQIHYVTAQDMGRYSCTVENKLGVSVASAQLLVEDAGG-TRLRDL---------HK 363

  Fly   448 NLSCLAMGIPNATI--------EWHWNGRKIKDLYDTNLKIVGTGPRSDLIVHPVTRQYYSGYKC 504
            .||.|.:.:.|.|:        :..|           .|:..|:.|           .|..|::.
Zfish   364 ELSALRVSLENVTVMSTASNMSQVMW-----------KLQSFGSQP-----------HYLEGFEV 406

  Fly   505 IATNIHGTAEHDMQLKEARVPDFVSEAKPSQLTATTMTFDIRGPSTELGLPILAYSVQYKEALNP 569
            :..::. .|..|...:  |||      :||..|..       ||        |....:|:..:.|
Zfish   407 LYRSLL-PASSDWTAQ--RVP------QPSLHTHV-------GP--------LKRGYKYEFKVRP 447

  Fly   570 DWSTAYNRSWSPDS---PYIVEGLRPQTEYSFRFAARNQVGLGNWGVNQQQSTPRRSAPEEPKPL 631
            ..|:.|.|..:...   |.||....||.......|.||.....:|               ||.| 
Zfish   448 YGSSLYGRESNTRHLRVPEIVPSAAPQDVSITMPAERNDTVHLSW---------------EPPP- 496

  Fly   632 HNPVQHDKEEPVVVSPYSDHFELRWGVPADNGEPIDRYQIKYCPGVKISGTWTELENSCNTVEVM 696
                 ||                     |.|| .|..||: :|       ..:|.:.|.|.....
Zfish   497 -----HD---------------------AHNG-IIQGYQV-WC-------VESEEQTSFNWTVDS 526

  Fly   697 ETTSFEMTQLVGNTYYRIELKAHNAIG---YSSPASIIMKTTRGIDVIQ--VAERQVFSSAAIVG 756
            .|.|.|:..|:.:..|.:.:.|.|..|   .|.|..:::::.......|  :.....|.|.....
Zfish   527 GTHSIEIFTLLPSRLYWVTVAAVNGAGVGVQSDPYKLLIESRLEATPYQTGILSMSHFVSVIKEP 591

  Fly   757 IAIGGVLLLLFVVDLLCCITVHMGVMATMCRKAKRSPSEIDDEAKLGSLY--------------- 806
            :.||.|..||:.|.::..:.::           :|.....:...|...||               
Zfish   592 VFIGSVGTLLWCVLMITAVFLY-----------RRHIRPANPSGKSSGLYRLESEDLIIKHRMAA 645

  Fly   807 --------GWR------------FPLPYCSG--------QLVKEPPP--SPLPLPPP-------- 833
                    |||            .|....||        .:.|:|.|  |.:|:.|.        
Zfish   646 PDSPWISGGWRPGSNSEPKQGLWTPSQENSGLRRTTLPITVKKDPNPLRSAVPIVPDNCGVYGTF 710

  Fly   834 -VKLGGSPMSTPLDEKEPLRTPTGSIK-QNS 862
             |.|.|:.:.|........|.|.|:.: |||
Zfish   711 YVDLTGNGLKTFNSPGRCPRMPHGNSQLQNS 741

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fas2NP_001284854.1 Ig 33..121 CDD:472250
Ig strand B 50..54 CDD:409353
Ig strand C 66..70 CDD:409353
Ig strand E 99..103 CDD:409353
Ig strand F 113..118 CDD:409353
Ig 139..209 CDD:472250 21/76 (28%)
Ig strand B 156..159 CDD:409353 0/2 (0%)
Ig strand C 168..172 CDD:409353 2/3 (67%)
Ig strand E 190..194 CDD:409353 0/3 (0%)
Ig strand F 204..209 CDD:409353 2/4 (50%)
IgI_4_MYLK-like 229..319 CDD:409568 23/91 (25%)
Ig strand A 229..232 CDD:409568 1/2 (50%)
Ig strand A' 238..241 CDD:409568 0/2 (0%)
Ig strand B 246..254 CDD:409568 2/7 (29%)
Ig strand C 260..264 CDD:409568 0/3 (0%)
Ig strand C' 267..270 CDD:409568 0/2 (0%)
Ig strand D 277..281 CDD:409568 0/3 (0%)
Ig strand E 285..290 CDD:409568 1/4 (25%)
Ig strand F 298..306 CDD:409568 4/7 (57%)
Ig strand G 309..319 CDD:409568 3/10 (30%)
IG_like 330..424 CDD:214653 22/94 (23%)
Ig strand B 339..343 CDD:409353 1/4 (25%)
Ig strand C 352..356 CDD:409353 1/3 (33%)
Ig strand E 388..394 CDD:409353 1/5 (20%)
Ig strand F 404..409 CDD:409353 2/4 (50%)
Ig 447..515 CDD:409353 12/75 (16%)
Ig strand B 447..451 CDD:409353 1/3 (33%)
Ig strand C 460..464 CDD:409353 1/11 (9%)
Ig strand E 487..491 CDD:409353 0/3 (0%)
Ig strand F 501..506 CDD:409353 1/4 (25%)
FN3 525..619 CDD:238020 21/96 (22%)
FN3 640..735 CDD:238020 20/97 (21%)
robo4XP_689255.3 IgC_1_Robo 71..169 CDD:409490 24/93 (26%)
Ig strand A 71..75 CDD:409490
Ig strand A' 78..83 CDD:409490 0/4 (0%)
Ig strand B 87..95 CDD:409490 1/7 (14%)
Ig strand C 101..106 CDD:409490 3/4 (75%)
Ig strand C' 109..111 CDD:409490 0/1 (0%)
Ig strand D 122..125 CDD:409490 0/2 (0%)
Ig strand E 128..134 CDD:409490 0/5 (0%)
Ig strand F 146..154 CDD:409490 3/7 (43%)
Ig strand G 157..169 CDD:409490 2/11 (18%)
IgI_2_Robo 176..261 CDD:409389 23/93 (25%)
Ig strand A 176..179 CDD:409389 1/8 (13%)
Ig strand A' 181..185 CDD:409389 1/3 (33%)
Ig strand B 189..196 CDD:409389 2/6 (33%)
Ig strand C 204..209 CDD:409389 1/4 (25%)
Ig strand C' 211..214 CDD:409389 0/2 (0%)
Ig strand D 220..224 CDD:409389 0/3 (0%)
Ig strand E 226..232 CDD:409389 2/5 (40%)
Ig strand F 239..247 CDD:409389 4/7 (57%)
Ig strand G 250..261 CDD:409389 3/10 (30%)
Ig 268..350 CDD:472250 22/98 (22%)
Ig strand B 282..286 CDD:409353 1/3 (33%)
Ig strand C 295..299 CDD:409353 1/3 (33%)
Ig strand E 316..320 CDD:409353 1/12 (8%)
Ig strand F 330..335 CDD:409353 2/4 (50%)
Ig strand G 343..346 CDD:409353 0/2 (0%)
FN3 373..448 CDD:214495 20/120 (17%)
FN3 472..560 CDD:238020 30/138 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.