DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fas2 and KIRREL1

DIOPT Version :9

Sequence 1:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster
Sequence 2:XP_005245362.1 Gene:KIRREL1 / 55243 HGNCID:15734 Length:773 Species:Homo sapiens


Alignment Length:510 Identity:116/510 - (22%)
Similarity:188/510 - (36%) Gaps:143/510 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 CSCSLIELTRAQSPILEIYPKQE--VQRKPV-----GKPLILTCRPTVPEPSLVADLQW------ 69
            |..:...|...::.:..:.|.::  :...||     |.|..||||....:|:  |.:.|      
Human   100 CQATEAALRSRRAKLTVLIPPEDTRIDGGPVILLQAGTPHNLTCRAFNAKPA--ATIIWFRDGTQ 162

  Fly    70 -----------KDNRNNT----ILPKPNGRNQPPMYT-----ETLPG-------------ESLAL 101
                       ||.:..|    :|..|...:...::|     |.:|.             .::.|
Human   163 QEGAVASTELLKDGKRETTVSQLLINPTDLDIGRVFTCRSMNEAIPSGKETSIELDVHHPPTVTL 227

  Fly   102 MITSLSVEMGGK--YYCTASYANTEIL----EKG------------------------VTIKTYV 136
            .|...:|:.|.:  :.|.|: ||.|||    .||                        |:.:.:.
Human   228 SIEPQTVQEGERVVFTCQAT-ANPEILGYRWAKGGFLIEDAHESRYETNVDYSFFTEPVSCEVHN 291

  Fly   137 AITWTN---------APE---NQYPT---LGQDYVVMCEVKADPNPTIDWLRN---------GDP 177
            .:..||         ||.   :..||   :|.|..:.|....:|..|:.|.:.         |.|
Human   292 KVGSTNVSTLVNVHFAPRIVVDPKPTTTDIGSDVTLTCVWVGNPPLTLTWTKKDSNMGPRPPGSP 356

  Fly   178 IRTTNDKYVV-QTNGLLIRNVQESDEGIYTCRAAVIETGELLERTIRVEVFIQ-PEIISLPTNLE 240
            ........|: .:|.||:::|.::|.|.|||||.|...| :.||  .|.:::. |.|||......
Human   357 PEAALSAQVLSNSNQLLLKSVTQADAGTYTCRAIVPRIG-VAER--EVPLYVNGPPIISSEAVQY 418

  Fly   241 AVEGKPFAANCTARGKPVPE-ISWIRDATQLNVATADRFQV---NPQTGL---VTISSVSQDDYG 298
            ||.|......|.....|.|: |:|......|.|.|.:|:.|   |..:|:   :||::|.:.|:.
Human   419 AVRGDGGKVECFIGSTPPPDRIAWAWKENFLEVGTLERYTVERTNSGSGVLSTLTINNVMEADFQ 483

  Fly   299 T-YTCLAKNRAGVVDQKTKLNVLVRPQIYELYNVTGARTKEIAITCRAKGRPAPAITF------- 355
            | |.|.|.|..|   ..|.:..|...::..:..:.||..          |.....|.|       
Human   484 THYNCTAWNSFG---PGTAIIQLEEREVLPVGIIAGATI----------GASILLIFFFIALVFF 535

  Fly   356 ---RRWGTQEEYTNGQQDDDPRII-LEP-NFDEERGESTGTLRISNAERSDDGLY 405
               ||.|::::.|..:.|.....: .|| ....:|.:.|.:  :|.|.|....:|
Human   536 LYRRRKGSRKDVTLRKLDIKVETVNREPLTMHSDREDDTAS--VSTATRVMKAIY 588

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fas2NP_001284854.1 IG_like 39..133 CDD:214653 33/169 (20%)
IG_like 144..226 CDD:214653 28/97 (29%)
IGc2 152..209 CDD:197706 18/66 (27%)
I-set 230..319 CDD:254352 30/96 (31%)
IGc2 243..309 CDD:197706 22/73 (30%)
IG_like 330..424 CDD:214653 18/88 (20%)
IGc2 339..412 CDD:197706 16/79 (20%)
Ig 447..518 CDD:143165
fn3 534..611 CDD:278470
FN3 640..735 CDD:238020
KIRREL1XP_005245362.1 I-set 22..116 CDD:254352 2/15 (13%)
Ig 25..116 CDD:299845 2/15 (13%)
Ig2_KIRREL3-like 138..219 CDD:143236 16/82 (20%)
I-set 223..304 CDD:254352 16/81 (20%)
Ig_2 227..305 CDD:290606 16/78 (21%)
Ig_2 311..405 CDD:290606 27/96 (28%)
IG_like 314..405 CDD:214653 27/93 (29%)
Ig5_KIRREL3 407..504 CDD:143306 30/99 (30%)
IG_like 416..504 CDD:214653 26/90 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.