DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fas2 and NTM

DIOPT Version :9

Sequence 1:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster
Sequence 2:NP_001338930.1 Gene:NTM / 50863 HGNCID:17941 Length:367 Species:Homo sapiens


Alignment Length:322 Identity:78/322 - (24%)
Similarity:130/322 - (40%) Gaps:56/322 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 NLEAVEGKPFAANCTARGKPVPEISWIRDATQLNVATADRFQVNPQTGL---------VTISSVS 293
            |:...:|:.....||...: |..::|:..:|.| .|..|::.::|:..|         :.|.:|.
Human    44 NVTVRQGESATLRCTIDNR-VTRVAWLNRSTIL-YAGNDKWCLDPRVVLLSNTQTQYSIEIQNVD 106

  Fly   294 QDDYGTYTCLAKNRAGVVDQKTKLNVLVRPQIYEL-YNVTGARTKEIAITCRAKGRPAPAITFRR 357
            ..|.|.|||..:........:..|.|.|.|:|.|: .:::......|::||.|.|||.|.:|:|.
Human   107 VYDEGPYTCSVQTDNHPKTSRVHLIVQVSPKIVEISSDISINEGNNISLTCIATGRPEPTVTWRH 171

  Fly   358 -------WGTQEEYTNGQQDDDPRIILEPNFDEERGESTGTLRISNAERSDDGLYQCIARNK-GA 414
                   :.:::||                           |.|....|...|.|:|.|.|. .|
Human   172 ISPKAVGFVSEDEY---------------------------LEIQGITREQSGDYECSASNDVAA 209

  Fly   415 DAYKTGHITVEFAPDFSHMKEL-PPVFSWEQRKANLSCLAMGIPNATIEWHWNGRKIKDLYDTNL 478
            ...:...:||.:.|..|..|.. .||    .:|..|.|.|..:|:|..:|:.:.:::.: ....:
Human   210 PVVRRVKVTVNYPPYISEAKGTGVPV----GQKGTLQCEASAVPSAEFQWYKDDKRLIE-GKKGV 269

  Fly   479 KIVGTGPRSDLIVHPVTRQYYSGYKCIATNIHGTAEHDMQLKEARVP---DFVSEAKPSQLT 537
            |:......|.||...|:...|..|.|:|:|..|.....:.|.|...|   ..:.|.|.:.||
Human   270 KVENRPFLSKLIFFNVSEHDYGNYTCVASNKLGHTNASIMLFELNEPTSSTLLQEVKTTALT 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fas2NP_001284854.1 IG_like 39..133 CDD:214653
IG_like 144..226 CDD:214653
IGc2 152..209 CDD:197706
I-set 230..319 CDD:254352 20/89 (22%)
IGc2 243..309 CDD:197706 18/74 (24%)
IG_like 330..424 CDD:214653 21/101 (21%)
IGc2 339..412 CDD:197706 19/79 (24%)
Ig 447..518 CDD:143165 17/70 (24%)
fn3 534..611 CDD:278470 2/4 (50%)
FN3 640..735 CDD:238020
NTMNP_001338930.1 Ig 44..132 CDD:416386 20/89 (22%)
Ig strand A' 44..49 CDD:409353 1/4 (25%)
Ig strand B 51..59 CDD:409353 1/7 (14%)
CDR1 59..63 CDD:409353 0/4 (0%)
FR2 64..70 CDD:409353 1/5 (20%)
Ig strand C 64..70 CDD:409353 1/5 (20%)
CDR2 71..83 CDD:409353 4/12 (33%)
Ig strand C' 72..76 CDD:409353 2/4 (50%)
Ig strand C' 80..83 CDD:409353 1/2 (50%)
FR3 84..118 CDD:409353 9/33 (27%)
Ig strand D 87..94 CDD:409353 1/6 (17%)
Ig strand E 97..103 CDD:409353 0/5 (0%)
Ig strand F 110..118 CDD:409353 4/7 (57%)
CDR3 119..123 CDD:409353 0/3 (0%)
Ig strand G 123..132 CDD:409353 1/8 (13%)
FR4 125..132 CDD:409353 1/6 (17%)
Ig_3 136..205 CDD:404760 22/95 (23%)
Ig strand A' 142..147 CDD:409353 0/4 (0%)
Ig strand B 153..160 CDD:409353 3/6 (50%)
Ig strand C 166..171 CDD:409353 1/4 (25%)
Ig strand D 177..180 CDD:409353 0/2 (0%)
Ig strand E 184..190 CDD:409353 4/32 (13%)
Ig strand F 197..204 CDD:409353 3/6 (50%)
Ig strand G 211..219 CDD:409353 0/7 (0%)
Ig_3 222..299 CDD:404760 21/81 (26%)
putative Ig strand A 223..229 CDD:409353 2/5 (40%)
Ig strand B 239..243 CDD:409353 1/3 (33%)
Ig strand C 252..256 CDD:409353 0/3 (0%)
Ig strand E 278..282 CDD:409353 2/3 (67%)
Ig strand F 292..297 CDD:409353 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.