Sequence 1: | NP_001284854.1 | Gene: | Fas2 / 31364 | FlyBaseID: | FBgn0000635 | Length: | 885 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001338930.1 | Gene: | NTM / 50863 | HGNCID: | 17941 | Length: | 367 | Species: | Homo sapiens |
Alignment Length: | 322 | Identity: | 78/322 - (24%) |
---|---|---|---|
Similarity: | 130/322 - (40%) | Gaps: | 56/322 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 238 NLEAVEGKPFAANCTARGKPVPEISWIRDATQLNVATADRFQVNPQTGL---------VTISSVS 293
Fly 294 QDDYGTYTCLAKNRAGVVDQKTKLNVLVRPQIYEL-YNVTGARTKEIAITCRAKGRPAPAITFRR 357
Fly 358 -------WGTQEEYTNGQQDDDPRIILEPNFDEERGESTGTLRISNAERSDDGLYQCIARNK-GA 414
Fly 415 DAYKTGHITVEFAPDFSHMKEL-PPVFSWEQRKANLSCLAMGIPNATIEWHWNGRKIKDLYDTNL 478
Fly 479 KIVGTGPRSDLIVHPVTRQYYSGYKCIATNIHGTAEHDMQLKEARVP---DFVSEAKPSQLT 537 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Fas2 | NP_001284854.1 | IG_like | 39..133 | CDD:214653 | |
IG_like | 144..226 | CDD:214653 | |||
IGc2 | 152..209 | CDD:197706 | |||
I-set | 230..319 | CDD:254352 | 20/89 (22%) | ||
IGc2 | 243..309 | CDD:197706 | 18/74 (24%) | ||
IG_like | 330..424 | CDD:214653 | 21/101 (21%) | ||
IGc2 | 339..412 | CDD:197706 | 19/79 (24%) | ||
Ig | 447..518 | CDD:143165 | 17/70 (24%) | ||
fn3 | 534..611 | CDD:278470 | 2/4 (50%) | ||
FN3 | 640..735 | CDD:238020 | |||
NTM | NP_001338930.1 | Ig | 44..132 | CDD:416386 | 20/89 (22%) |
Ig strand A' | 44..49 | CDD:409353 | 1/4 (25%) | ||
Ig strand B | 51..59 | CDD:409353 | 1/7 (14%) | ||
CDR1 | 59..63 | CDD:409353 | 0/4 (0%) | ||
FR2 | 64..70 | CDD:409353 | 1/5 (20%) | ||
Ig strand C | 64..70 | CDD:409353 | 1/5 (20%) | ||
CDR2 | 71..83 | CDD:409353 | 4/12 (33%) | ||
Ig strand C' | 72..76 | CDD:409353 | 2/4 (50%) | ||
Ig strand C' | 80..83 | CDD:409353 | 1/2 (50%) | ||
FR3 | 84..118 | CDD:409353 | 9/33 (27%) | ||
Ig strand D | 87..94 | CDD:409353 | 1/6 (17%) | ||
Ig strand E | 97..103 | CDD:409353 | 0/5 (0%) | ||
Ig strand F | 110..118 | CDD:409353 | 4/7 (57%) | ||
CDR3 | 119..123 | CDD:409353 | 0/3 (0%) | ||
Ig strand G | 123..132 | CDD:409353 | 1/8 (13%) | ||
FR4 | 125..132 | CDD:409353 | 1/6 (17%) | ||
Ig_3 | 136..205 | CDD:404760 | 22/95 (23%) | ||
Ig strand A' | 142..147 | CDD:409353 | 0/4 (0%) | ||
Ig strand B | 153..160 | CDD:409353 | 3/6 (50%) | ||
Ig strand C | 166..171 | CDD:409353 | 1/4 (25%) | ||
Ig strand D | 177..180 | CDD:409353 | 0/2 (0%) | ||
Ig strand E | 184..190 | CDD:409353 | 4/32 (13%) | ||
Ig strand F | 197..204 | CDD:409353 | 3/6 (50%) | ||
Ig strand G | 211..219 | CDD:409353 | 0/7 (0%) | ||
Ig_3 | 222..299 | CDD:404760 | 21/81 (26%) | ||
putative Ig strand A | 223..229 | CDD:409353 | 2/5 (40%) | ||
Ig strand B | 239..243 | CDD:409353 | 1/3 (33%) | ||
Ig strand C | 252..256 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 278..282 | CDD:409353 | 2/3 (67%) | ||
Ig strand F | 292..297 | CDD:409353 | 2/4 (50%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |