DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fas2 and dpr12

DIOPT Version :9

Sequence 1:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster
Sequence 2:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster


Alignment Length:298 Identity:60/298 - (20%)
Similarity:106/298 - (35%) Gaps:90/298 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 LILTCRPTV--------PEPSLVADLQWK----------DNRNNTILPKPNGRNQPPMYTETLPG 96
            ::|.|.||:        .:.|::.|..||          |::.:..|..    :..||:      
  Fly    23 ILLLCLPTLLLATTLEPDQKSILTDNDWKKLWMRGGINGDSKLDNNLDS----SDSPMF------ 77

  Fly    97 ESLALMITSLSVEMGGKYYCTASYANTEILEKGVTIKTYVAITWTNAPENQYPTLGQDYVVMCEV 161
            |...||..:.:|::||..:.....:..:          .|.:.|     ||              
  Fly    78 EDSELMAHNTTVQLGGTAFLVCKVSGVD----------RVGVNW-----NQ-------------- 113

  Fly   162 KADPNPTIDWLR--------NGDPIRTTNDKY-VVQTNG-----LLIRNVQESDEGIYTCRAAVI 212
                   |.|:|        :|..:.|.:::: ::.|.|     |.|:.||..|.|:|.|:.:. 
  Fly   114 -------ISWIRRRDWHILSSGAQLYTNDERFAILHTPGSNMWTLQIKFVQRRDHGMYECQVST- 170

  Fly   213 ETGELLERTIRVEVFIQPEIISLPTNLEAVEGKPFAANCTARGKPVPE--ISWIRDATQLNVATA 275
            .|| ::...:.::|.:....|.....|....|......|.....|.|.  :.|.::...:|...:
  Fly   171 PTG-IISHFVNLQVVVPEAFILGSGELHVDMGSTINLVCIIEKSPTPPQYVYWQKNDRLINYVDS 234

  Fly   276 DR---FQVNP----QTGLVTISSVSQDDYGTYTCLAKN 306
            .|   .:..|    |:.|: |......|.|.|||.|.|
  Fly   235 RRDITIETTPGPRTQSRLI-IREPQVTDSGNYTCSASN 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fas2NP_001284854.1 IG_like 39..133 CDD:214653 18/100 (18%)
IG_like 144..226 CDD:214653 19/95 (20%)
IGc2 152..209 CDD:197706 15/70 (21%)
I-set 230..319 CDD:254352 20/86 (23%)
IGc2 243..309 CDD:197706 18/73 (25%)
IG_like 330..424 CDD:214653
IGc2 339..412 CDD:197706
Ig 447..518 CDD:143165
fn3 534..611 CDD:278470
FN3 640..735 CDD:238020
dpr12NP_652462.3 IG 86..183 CDD:214652 24/134 (18%)
Ig_3 193..271 CDD:404760 18/78 (23%)
Ig strand B 204..208 CDD:409353 0/3 (0%)
Ig strand C 219..223 CDD:409353 0/3 (0%)
Ig strand E 250..254 CDD:409353 1/4 (25%)
Ig strand F 264..269 CDD:409353 3/4 (75%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.