DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fas2 and dpr6

DIOPT Version :9

Sequence 1:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster
Sequence 2:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster


Alignment Length:364 Identity:84/364 - (23%)
Similarity:127/364 - (34%) Gaps:110/364 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 VEVFIQPEIISLPTNLEAVEGKPFAANCTARGKPVPEISWI--RDATQLNVA----TAD-RFQV- 280
            :|.:..|   |.|.|:.|:.||....:|..|......:|||  ||...|.|.    |:| |||. 
  Fly    71 MEPYFDP---STPRNVTALMGKSAYLSCRVRNLANKTVSWIRHRDIHILTVGSYTYTSDQRFQAT 132

  Fly   281 ---NPQTGLVTISSVSQDDYGTYTCLAKNRAGVVDQKTKLNVLV-------RPQIYELYNVTGAR 335
               :.:...:.|....:.|.|.|.|....:. |.....:|||:|       .|.::    |....
  Fly   133 HHQDTEDWTLQIKWAQKRDAGMYECQISTQP-VRSYFVRLNVVVPTATILGGPDLH----VDKGS 192

  Fly   336 TKEIAITCRAKGRP-APAITFRRWGTQEEYTNGQQDDDPRIILEPNFDEERG----------EST 389
            |  |.:||..|..| .||..|  |...||..              |:|..||          .:|
  Fly   193 T--INLTCTVKFSPEPPAYIF--WYHHEEVI--------------NYDSSRGGVSVITEKGDVTT 239

  Fly   390 GTLRISNAERSDDGLYQCIARNKGADAYKTGHITVEFAPDFSHMKELPPVFSWEQRKANLSCLAM 454
            ..|.|.||:.:|.|.|.|...|....:.:.            |:..:..:.|.|..:      ||
  Fly   240 SFLLIQNADLADSGKYSCAPSNADVASVRV------------HVLNVRAIISGEHPE------AM 286

  Fly   455 GIPNATIEWHWNGRKIKDLYDTNLKIVGTGPRSDLIVHPVTRQYYSGYKC---IATNIHGTAEHD 516
            ...::..:::|            |.||       |::..|.  .||..:|   :..::..:....
  Fly   287 QTGSSGCQYNW------------LTIV-------LLLGLVL--CYSSQQCSSAVPASLTSSLPLP 330

  Fly   517 MQLK-------------EARVPDFVSEAKPSQLTATTMT 542
            .||.             |:...:.|:.|:.|..|.||.|
  Fly   331 SQLPLPAAAAATTTATGESASSESVTAARASAATTTTTT 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fas2NP_001284854.1 IG_like 39..133 CDD:214653
IG_like 144..226 CDD:214653 0/1 (0%)
IGc2 152..209 CDD:197706
I-set 230..319 CDD:254352 28/99 (28%)
IGc2 243..309 CDD:197706 21/76 (28%)
IG_like 330..424 CDD:214653 27/104 (26%)
IGc2 339..412 CDD:197706 24/83 (29%)
Ig 447..518 CDD:143165 11/73 (15%)
fn3 534..611 CDD:278470 5/9 (56%)
FN3 640..735 CDD:238020
dpr6NP_001287018.1 V-set 79..174 CDD:284989 27/95 (28%)
IG_like 80..175 CDD:214653 28/95 (29%)
IG_like 184..271 CDD:214653 28/120 (23%)
IGc2 191..262 CDD:197706 25/88 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.