DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fas2 and Nrcam

DIOPT Version :10

Sequence 1:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster
Sequence 2:XP_038968603.1 Gene:Nrcam / 497815 RGDID:3209 Length:1311 Species:Rattus norvegicus


Alignment Length:825 Identity:184/825 - (22%)
Similarity:300/825 - (36%) Gaps:218/825 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 AQSPILEIYPKQEVQRKPV----GKPLILTCRPTVPEPSLVADLQWKDNRNNTILPK----PNGR 84
            ::||   ::.|:.::  |:    |:.|:|.|||.:..|..:  :.|.||.... ||:    ..|.
  Rat   146 SRSP---LWTKERLE--PIILRSGQSLVLPCRPPIGLPPAI--IFWMDNSFQR-LPQSERVSQGL 202

  Fly    85 NQPPMYTETLPGESLALMITSLSVEMGGKYYCTASYANTEILE-------KGVTIKTYVAITWTN 142
            |....::..||.::..            .|.|.|.:.:|:.::       |.:::.........|
  Rat   203 NGDLYFSNVLPEDTRE------------DYICYARFNHTQTIQQKQPISLKVISVDELNDTIAAN 255

  Fly   143 APENQY----------PTL--------------GQDYVVMCEVKADPNPTIDWLRNGD--PIRTT 181
            ..:.::          ||.              |....:.|..:..|.|.|.|::...  |:..|
  Rat   256 LSDTEFYGAKSSKERPPTFLTPEGNESHKEELRGNVLSLECIAEGLPTPVIYWIKEDGTLPVNRT 320

  Fly   182 ---NDKYVVQTNGLLIRNVQESDEGIYTCRAAVIETGEL--LERTIRVEVFIQPEIISLPTNLEA 241
               |.|..:|     |.:|.|:|.|.|.|    |....|  :..||.|.|...|..|..|.||..
  Rat   321 FYRNFKKTLQ-----IIHVSEADSGNYQC----IAKNALGAVHHTISVTVKAAPYWIVAPHNLVL 376

  Fly   242 VEGKPFAANCTARGKPVPEISWIRDATQLNVATAD-RFQVNPQTGLVTISSVSQDDYGTYTCLAK 305
            ..|:.....|.|.|.|.|.|||:.:...:.:|..| ..:::..|  :..|:|.:.....|.|.|.
  Rat   377 SPGENGTLICRANGNPKPRISWLTNGVPVEIALDDPSRKIDGDT--IMFSNVQESSSAVYQCNAS 439

  Fly   306 NRAGVVDQKTKLNVLVRP-----QIYELYNVTGARTKEIAITCRAKGRPAPAITFRRWGTQEEYT 365
            |:.|.:.....:|||..|     ....||.|...|  ...:.|...|.|.|.|.:.:.      |
  Rat   440 NKYGYLLANAFVNVLAEPPRILTSANTLYQVIANR--PALLDCAFFGSPMPTIEWFKG------T 496

  Fly   366 NGQQDDDPRIILEPNFDEERGESTGTLRISNAERSDDGLYQCIARNKGADAYKTGHITVEFAPDF 430
            .|....:...:|..|         |||.|..|::...|.|.|:||||...|....|:.::....|
  Rat   497 KGSALHEDIYVLHDN---------GTLEIPVAQKDSTGTYTCVARNKLGMAKNEVHLEIKDPTRF 552

  Fly   431 SHMKELPPVFSWEQR--KANLSCLAMG----IPNATIEWHWNGRKIKDLYDTNLKIVGTGPRSD- 488
              :|:  |.::..||  |.:..|....    ||  ||.|              ||..|..|..: 
  Rat   553 --IKQ--PEYAVVQRGSKVSFECKVKHDHTLIP--TILW--------------LKDNGELPNDER 597

  Fly   489 -------LIVHPVTRQYYSGYKCIATNIHGTAEHDMQLKEARVPDFVSEAKPSQLTATTMT---- 542
                   |:|..|..:....|.|.|..               ..|.||.:...::.|.|.|    
  Rat   598 FSVDKDHLVVSDVKDEDGGTYTCAANT---------------TLDSVSASAVLRVVAPTPTPAPI 647

  Fly   543 FDIRGPSTELGL--------------------PILAYSVQYKEALNPDWSTAYNRSWSPDSPYIV 587
            :|:..|..:|.|                    ||..:.::|::|::......:....|.......
  Rat   648 YDVPNPPFDLELTNQLDKSVQLTWTPGDDNNSPITKFIIEYEDAMHEAGLWRHQAEVSGTQTTAQ 712

  Fly   588 EGLRPQTEYSFRFAARNQVGLGNWGVNQQQSTPRRSAPEE---------PKPLHNP--VQHDKEE 641
            ..|.|...||||..|.|.:|              ||.|.|         .:|..||  |:....|
  Rat   713 LKLSPYVNYSFRVMAENSIG--------------RSVPSEASEQYLTKAAEPDQNPTAVEGLGTE 763

  Fly   642 PVVVSPYSDHFELRWGVPADNGEPIDRYQIKYCPGVKISGTWTEL--ENSCNTVEVMETTSFEMT 704
            |       |:..:.|       :|::.:| ...||::...:|.:.  ::...:|.|...:.:.::
  Rat   764 P-------DNLVITW-------KPLNGFQ-SNGPGLQYKVSWRQKDGDDEWTSVVVANVSKYIVS 813

  Fly   705 QLVGNTYYRIELKAHNAIGYS-SPASIIMKTTRGIDVIQVAERQV 748
            .......|.|:::|.|.:|:: .||:::..:  |.|:..||...|
  Rat   814 GTPTFVPYLIKVQALNDVGFAPEPAAVMGHS--GEDLPMVAPGNV 856

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fas2NP_001284854.1 Ig 33..121 CDD:472250 21/95 (22%)
Ig strand B 50..54 CDD:409353 2/3 (67%)
Ig strand C 66..70 CDD:409353 0/3 (0%)
Ig strand E 99..103 CDD:409353 0/3 (0%)
Ig strand F 113..118 CDD:409353 2/4 (50%)
Ig 139..209 CDD:472250 21/98 (21%)
Ig strand B 156..159 CDD:409353 0/2 (0%)
Ig strand C 168..172 CDD:409353 1/3 (33%)
Ig strand E 190..194 CDD:409353 0/3 (0%)
Ig strand F 204..209 CDD:409353 2/4 (50%)
IgI_4_MYLK-like 229..319 CDD:409568 24/90 (27%)
Ig strand A 229..232 CDD:409568 1/2 (50%)
Ig strand A' 238..241 CDD:409568 2/2 (100%)
Ig strand B 246..254 CDD:409568 1/7 (14%)
Ig strand C 260..264 CDD:409568 2/3 (67%)
Ig strand C' 267..270 CDD:409568 0/2 (0%)
Ig strand D 277..281 CDD:409568 0/3 (0%)
Ig strand E 285..290 CDD:409568 0/4 (0%)
Ig strand F 298..306 CDD:409568 3/7 (43%)
Ig strand G 309..319 CDD:409568 1/9 (11%)
IG_like 330..424 CDD:214653 25/93 (27%)
Ig strand B 339..343 CDD:409353 0/3 (0%)
Ig strand C 352..356 CDD:409353 1/3 (33%)
Ig strand E 388..394 CDD:409353 3/5 (60%)
Ig strand F 404..409 CDD:409353 2/4 (50%)
Ig 447..515 CDD:409353 16/79 (20%)
Ig strand B 447..451 CDD:409353 0/3 (0%)
Ig strand C 460..464 CDD:409353 2/3 (67%)
Ig strand E 487..491 CDD:409353 1/11 (9%)
Ig strand F 501..506 CDD:409353 2/4 (50%)
FN3 525..619 CDD:238020 24/117 (21%)
FN3 640..735 CDD:238020 18/97 (19%)
NrcamXP_038968603.1 IgI_NrCAM 50..144 CDD:409458
Ig strand A 50..54 CDD:409458
Ig strand A' 59..63 CDD:409458
Ig strand B 68..75 CDD:409458
Ig strand C 81..86 CDD:409458
Ig strand C' 89..91 CDD:409458
Ig strand D 98..101 CDD:409458
Ig strand E 106..110 CDD:409458
Ig strand F 123..131 CDD:409458
Ig strand G 134..144 CDD:409458
Ig 153..242 CDD:472250 22/105 (21%)
Ig strand B 167..171 CDD:409353 2/3 (67%)
Ig strand C 181..185 CDD:409353 0/5 (0%)
Ig strand E 204..208 CDD:409353 0/3 (0%)
Ig strand F 219..224 CDD:409353 2/4 (50%)
Ig strand G 235..238 CDD:409353 0/2 (0%)
Ig 281..362 CDD:472250 23/89 (26%)
Ig strand B 292..296 CDD:409353 0/3 (0%)
Ig strand C 305..309 CDD:409353 1/3 (33%)
Ig strand E 327..331 CDD:409353 1/8 (13%)
Ig strand F 341..346 CDD:409353 2/8 (25%)
Ig strand G 354..357 CDD:409353 0/2 (0%)
Ig 366..454 CDD:472250 24/89 (27%)
Ig strand B 382..386 CDD:409353 0/3 (0%)
Ig strand C 395..399 CDD:409353 2/3 (67%)
Ig strand E 419..423 CDD:409353 1/5 (20%)
Ig strand F 433..438 CDD:409353 2/4 (50%)
Ig strand G 446..449 CDD:409353 0/2 (0%)
Ig 460..546 CDD:472250 27/102 (26%)
Ig strand B 476..480 CDD:409353 0/3 (0%)
Ig strand C 489..493 CDD:409353 1/3 (33%)
Ig strand E 512..516 CDD:409353 3/3 (100%)
Ig strand F 526..531 CDD:409353 2/4 (50%)
Ig strand G 539..542 CDD:409353 0/2 (0%)
Ig 553..637 CDD:472250 24/116 (21%)
Ig strand B 567..571 CDD:409353 0/3 (0%)
Ig strand C 582..586 CDD:409353 3/17 (18%)
Ig strand E 604..607 CDD:409353 1/2 (50%)
Ig strand F 617..622 CDD:409353 2/4 (50%)
Ig strand G 630..633 CDD:409353 1/2 (50%)
FN3 651..741 CDD:238020 21/103 (20%)
fn3 754..836 CDD:394996 18/96 (19%)
fn3 852..944 CDD:394996 2/5 (40%)
FN3 <920..>1154 CDD:442628
fn3 957..1041 CDD:394996
Bravo_FIGEY 1198..1287 CDD:464016
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.