| Sequence 1: | NP_001284854.1 | Gene: | Fas2 / 31364 | FlyBaseID: | FBgn0000635 | Length: | 885 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001306032.1 | Gene: | OPCML / 4978 | HGNCID: | 8143 | Length: | 354 | Species: | Homo sapiens |
| Alignment Length: | 306 | Identity: | 80/306 - (26%) |
|---|---|---|---|
| Similarity: | 128/306 - (41%) | Gaps: | 46/306 - (15%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 125 ILEKGVTIKTYVAITWTNAPENQYPTLGQDYVVMCEVKADPNPTIDWLRNGDPIRTTNDKY---- 185
Fly 186 --VVQTN-----GLLIRNVQESDEGIYTCRAAVIETGELLERTIRVEVFIQ--PEIISLPTNLEA 241
Fly 242 VEGKPFAANCTARGKPVPEISWIRDATQLNVATADRFQVNPQTGLVTISSVSQDDYGTYTCLAKN 306
Fly 307 RAGVVD-QKTKLNVLVRPQIYELYNVTGARTKEIAI-TCRAKGRPAPAITFRRWGTQEEYTNGQQ 369
Fly 370 DDDPRIILEPNFDEERGESTG---TLRISNAERSDDGLYQCIARNK 412 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Fas2 | NP_001284854.1 | IG_like | 39..133 | CDD:214653 | 2/7 (29%) |
| IG_like | 144..226 | CDD:214653 | 23/92 (25%) | ||
| IGc2 | 152..209 | CDD:197706 | 18/67 (27%) | ||
| I-set | 230..319 | CDD:254352 | 24/89 (27%) | ||
| IGc2 | 243..309 | CDD:197706 | 19/65 (29%) | ||
| IG_like | 330..424 | CDD:214653 | 24/87 (28%) | ||
| IGc2 | 339..412 | CDD:197706 | 19/76 (25%) | ||
| Ig | 447..518 | CDD:143165 | |||
| fn3 | 534..611 | CDD:278470 | |||
| FN3 | 640..735 | CDD:238020 | |||
| OPCML | NP_001306032.1 | Ig | 44..132 | CDD:416386 | 23/92 (25%) |
| Ig strand A' | 44..49 | CDD:409353 | 1/4 (25%) | ||
| Ig strand B | 51..59 | CDD:409353 | 1/7 (14%) | ||
| CDR1 | 59..63 | CDD:409353 | 1/4 (25%) | ||
| FR2 | 64..70 | CDD:409353 | 1/5 (20%) | ||
| Ig strand C | 64..70 | CDD:409353 | 1/5 (20%) | ||
| CDR2 | 71..83 | CDD:409353 | 3/11 (27%) | ||
| Ig strand C' | 72..76 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C' | 80..83 | CDD:409353 | 2/2 (100%) | ||
| FR3 | 84..118 | CDD:409353 | 10/36 (28%) | ||
| Ig strand D | 87..94 | CDD:409353 | 0/6 (0%) | ||
| Ig strand E | 97..103 | CDD:409353 | 0/5 (0%) | ||
| Ig strand F | 110..118 | CDD:409353 | 5/10 (50%) | ||
| CDR3 | 119..123 | CDD:409353 | 1/4 (25%) | ||
| Ig strand G | 123..132 | CDD:409353 | 3/8 (38%) | ||
| FR4 | 125..132 | CDD:409353 | 3/6 (50%) | ||
| Ig_3 | 135..206 | CDD:404760 | 20/76 (26%) | ||
| Ig strand A | 135..138 | CDD:409353 | 1/2 (50%) | ||
| Ig strand A' | 144..148 | CDD:409353 | 0/3 (0%) | ||
| Ig strand B | 151..160 | CDD:409353 | 1/8 (13%) | ||
| Ig strand C | 165..170 | CDD:409353 | 2/8 (25%) | ||
| Ig strand C' | 171..174 | CDD:409353 | 1/2 (50%) | ||
| Ig strand F | 198..206 | CDD:409353 | 4/7 (57%) | ||
| Ig | 224..312 | CDD:416386 | 26/94 (28%) | ||
| putative Ig strand A | 224..230 | CDD:409353 | 2/5 (40%) | ||
| Ig strand B | 240..244 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 253..257 | CDD:409353 | 0/6 (0%) | ||
| Ig strand E | 279..283 | CDD:409353 | 2/3 (67%) | ||
| Ig strand F | 293..298 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 306..309 | CDD:409353 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||