DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fas2 and NCAM1

DIOPT Version :10

Sequence 1:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster
Sequence 2:NP_001387553.1 Gene:NCAM1 / 4684 HGNCID:7656 Length:1129 Species:Homo sapiens


Alignment Length:815 Identity:218/815 - (26%)
Similarity:349/815 - (42%) Gaps:108/815 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SLIELTRAQSPILEIYPKQ-EVQRKPVGKPLILTCRPTVPEPSLVADLQWKDNRNNTILPKPNGR 84
            :|..|..|.|..::|.|.| |:.   ||:.....|:  |...:...|:.|.         .|||.
Human    10 TLFFLGTAVSLQVDIVPSQGEIS---VGESKFFLCQ--VAGDAKDKDISWF---------SPNGE 60

  Fly    85 ----NQPPMYTETLPGESLALMITSLSVEMGGKYYCTASYANTEILEKGVTIKTYVAITWTNAPE 145
                ||..:........|..|.|.:.:::..|.|.|..:..:....|..|.:|.:..:.:.|||.
Human    61 KLTPNQQRISVVWNDDSSSTLTIYNANIDDAGIYKCVVTGEDGSESEATVNVKIFQKLMFKNAPT 125

  Fly   146 NQYPTLGQDYVVMCEVKADPNPTIDWLRNG-DPIRTTNDKYVVQTNGLL-IRNVQESDEGIYTCR 208
            .|....|:|.|::|:|.:...|||.|...| |.|...:.:::|.:|..| ||.::::|||.|.|.
Human   126 PQEFREGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIKKTDEGTYRCE 190

  Fly   209 AAVIETGELLERTIRVEVFIQP------EIISLPTNLEAVEGKPFAANCTARGKPVPEISWIRDA 267
            ..::..||:..:.|:|.|.:.|      .|::...||    |:.....|.|.|.|.|.:||.:|.
Human   191 GRILARGEINFKDIQVIVNVPPTIQARQNIVNATANL----GQSVTLVCDAEGFPEPTMSWTKDG 251

  Fly   268 TQLNVATAD-RFQVNPQTGLVTISSVSQDDYGTYTCLAKNRAGVVDQKTKLNVLVRPQIYELYNV 331
            .|:.....| ::..:..:..:||..|.::|...|.|:|:|:||..|....|.|..:|:|..:.|.
Human   252 EQIEQEEDDEKYIFSDDSSQLTIKKVDKNDEAEYICIAENKAGEQDATIHLKVFAKPKITYVENQ 316

  Fly   332 TGARTKE-IAITCRAKGRPAPAITFR------------RWGTQEEYTNGQQDDDPRIILEPNFDE 383
            |....:| :.:||.|.|.|.|:||:|            .|...|:    |:..|..:::..:   
Human   317 TAMELEEQVTLTCEASGDPIPSITWRTSTRNISSEEKASWTRPEK----QETLDGHMVVRSH--- 374

  Fly   384 ERGESTGTLRISNAERSDDGLYQCIARNKGADAYKTGHITVEFAPDFSHMKELPPVFSWEQRKAN 448
               ....:|.:.:.:.:|.|.|.|.|.|......::.::.|::||   .::....|::||..:.|
Human   375 ---ARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAP---KLQGPVAVYTWEGNQVN 433

  Fly   449 LSCLAMGIPNATIEWHWNGRKIKDLYDTNLKIVGTGPRSDLIVHPVTRQYYSGYKCIATNIHGTA 513
            ::|.....|:|||.|..:|:.:.....:|:||..|...|.|.|.|.:...:..|.|.|.|..|..
Human   434 ITCEVFAYPSATISWFRDGQLLPSSNYSNIKIYNTPSASYLEVTPDSENDFGNYNCTAVNRIGQE 498

  Fly   514 EHDMQLKEARVPD--FVSEAKPSQLTATTMTFDIRGPSTELGLPILAYSVQYK----EALNPDWS 572
            ..:..|.:|..|.  .:.:.:|...|| .:.||  .|....|:|||.|..:::    |..:..|.
Human   499 SLEFILVQADTPSSPSIDQVEPYSSTA-QVQFD--EPEATGGVPILKYKAEWRAVGEEVWHSKWY 560

  Fly   573 TAYNRSWSPDSPYIVEGLRPQTEYSFRFAARNQVGLGNWGVNQQQSTPRRSAPEEPKPLHNPVQH 637
            .|  :..|.:....:.||:|:|.|:.|.||.|..|||......:..|.....|..|| |...:..
Human   561 DA--KEASMEGIVTIVGLKPETTYAVRLAALNGKGLGEISAASEFKTQPVREPSAPK-LEGQMGE 622

  Fly   638 DKEEPVVVSPYSDHFELRWGVPADNGEPIDRYQIKYCPGVKISGTW-TELENSCNTVEVMETTSF 701
            |.....|.....|          |.|.||..|.::|   ..:|..| .|:.....:..||     
Human   623 DGNSIKVNLIKQD----------DGGSPIRHYLVRY---RALSSEWKPEIRLPSGSDHVM----- 669

  Fly   702 EMTQLVGNTYYRIELKAHNAIGYSSPASIIMKTTRGIDVIQV--AERQVFSSAAIVGIAIGGVLL 764
             :..|..|..|.:.:.|.|..|.|..|..:.:|:.....|..  :.....|:.|||||.|...:|
Human   670 -LKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTSAQPTAIPANGSPTSGLSTGAIVGILIVIFVL 733

  Fly   765 LLFVVDLLC----------CITVHMGVMATMCRKA 789
            ||.|||:.|          ||.|:      :|.||
Human   734 LLVVVDITCYFLNKCGLFMCIAVN------LCGKA 762

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fas2NP_001284854.1 Ig 33..121 CDD:472250 21/92 (23%)
Ig strand B 50..54 CDD:409353 0/3 (0%)
Ig strand C 66..70 CDD:409353 1/3 (33%)
Ig strand E 99..103 CDD:409353 1/3 (33%)
Ig strand F 113..118 CDD:409353 2/4 (50%)
Ig 139..209 CDD:472250 26/71 (37%)
Ig strand B 156..159 CDD:409353 1/2 (50%)
Ig strand C 168..172 CDD:409353 2/3 (67%)
Ig strand E 190..194 CDD:409353 2/4 (50%)
Ig strand F 204..209 CDD:409353 2/4 (50%)
IgI_4_MYLK-like 229..319 CDD:409568 27/96 (28%)
Ig strand A 229..232 CDD:409568 1/8 (13%)
Ig strand A' 238..241 CDD:409568 2/2 (100%)
Ig strand B 246..254 CDD:409568 1/7 (14%)
Ig strand C 260..264 CDD:409568 1/3 (33%)
Ig strand C' 267..270 CDD:409568 0/2 (0%)
Ig strand D 277..281 CDD:409568 0/3 (0%)
Ig strand E 285..290 CDD:409568 1/4 (25%)
Ig strand F 298..306 CDD:409568 3/7 (43%)
Ig strand G 309..319 CDD:409568 3/9 (33%)
IG_like 330..424 CDD:214653 23/106 (22%)
Ig strand B 339..343 CDD:409353 0/3 (0%)
Ig strand C 352..356 CDD:409353 2/3 (67%)
Ig strand E 388..394 CDD:409353 1/5 (20%)
Ig strand F 404..409 CDD:409353 2/4 (50%)
Ig 447..515 CDD:409353 21/67 (31%)
Ig strand B 447..451 CDD:409353 1/3 (33%)
Ig strand C 460..464 CDD:409353 2/3 (67%)
Ig strand E 487..491 CDD:409353 2/3 (67%)
Ig strand F 501..506 CDD:409353 2/4 (50%)
FN3 525..619 CDD:238020 28/99 (28%)
FN3 640..735 CDD:238020 21/95 (22%)
NCAM1NP_001387553.1 IgI_1_NCAM-1 20..116 CDD:409451 24/109 (22%)
Ig strand A 20..25 CDD:409451 0/4 (0%)
Ig strand A' 28..32 CDD:409451 2/3 (67%)
Ig strand B 34..44 CDD:409451 2/11 (18%)
Ig strand C 50..56 CDD:409451 2/14 (14%)
Ig strand C' 59..61 CDD:409451 1/1 (100%)
Ig strand D 69..75 CDD:409451 0/5 (0%)
Ig strand E 77..85 CDD:409451 3/7 (43%)
Ig strand F 92..100 CDD:409451 3/7 (43%)
Ig strand G 104..115 CDD:409451 3/10 (30%)
IG_like 124..190 CDD:214653 23/65 (35%)
Ig strand B 135..139 CDD:409353 1/3 (33%)
Ig strand C 148..152 CDD:409353 2/3 (67%)
Ig strand E 172..176 CDD:409353 1/3 (33%)
Ig 211..307 CDD:472250 28/99 (28%)
Ig strand B 231..235 CDD:409353 0/3 (0%)
Ig strand C 244..248 CDD:409353 1/3 (33%)
Ig strand E 270..274 CDD:409353 0/3 (0%)
Ig strand F 284..289 CDD:409353 2/4 (50%)
Ig strand G 297..300 CDD:409353 1/2 (50%)
IgI_NCAM-1 306..412 CDD:143277 25/115 (22%)
Ig strand A 306..311 CDD:143277 1/4 (25%)
Ig strand A' 315..319 CDD:143277 2/3 (67%)
Ig strand B 324..332 CDD:143277 2/7 (29%)
Ig strand C 338..344 CDD:143277 3/5 (60%)
Ig strand C' 347..350 CDD:143277 0/2 (0%)
Ig strand D 368..374 CDD:143277 0/5 (0%)
Ig strand E 377..383 CDD:143277 1/5 (20%)
Ig strand F 391..399 CDD:143277 4/7 (57%)
Ig strand G 402..412 CDD:143277 0/9 (0%)
IG_like 421..499 CDD:214653 24/77 (31%)
Ig strand B 432..436 CDD:409353 1/3 (33%)
Ig strand C 445..449 CDD:409353 2/3 (67%)
Ig strand E 472..476 CDD:409353 2/3 (67%)
Ig strand F 486..491 CDD:409353 2/4 (50%)
fn3 511..598 CDD:394996 27/91 (30%)
fn3 612..693 CDD:394996 23/100 (23%)
PRK12323 <913..1108 CDD:481241
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.