DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fas2 and dpr5

DIOPT Version :9

Sequence 1:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster
Sequence 2:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster


Alignment Length:212 Identity:51/212 - (24%)
Similarity:77/212 - (36%) Gaps:41/212 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 LPTNLEAVE---------------GKPFAANCTARGKPVPEISWIRDATQLNVATA--------D 276
            :|.|.:|::               |.....:|..|......:||||. ..|::.|.        .
  Fly    81 IPDNYDAIDPVFDNTTDREVIAALGTTARLHCRVRHLGDRAVSWIRQ-RDLHILTIGIMTYTNDQ 144

  Fly   277 RFQV----NPQTGLVTISSVSQDDYGTYTCLAKNRAGVVDQKTKLNVLVRPQIY---ELYNVTGA 334
            ||..    |....::.|.||.|.|.|.|.|.......:......:.|..:.||.   ||:..:|:
  Fly   145 RFLARHIDNSDEWVLKIVSVQQRDAGVYECQVSTEPKISLAYKLVVVTSKAQILANRELFIQSGS 209

  Fly   335 RTKEIAITCRAKGRPAPAITFRRWGTQEEYTNGQQDDDPRIILEPNFDEERGESTGTLRISNAER 399
               :|.:||.|...|.| .|...|....|..:.......|:      :.|:...|..|.||..:.
  Fly   210 ---DINLTCIAPQAPGP-YTHMLWHKDTELVSDSARGGIRV------ESEQQMKTSNLVISRVQH 264

  Fly   400 SDDGLYQCIARNKGADA 416
            :|.|.|.|.|.|..:|:
  Fly   265 TDSGNYTCSADNSNSDS 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fas2NP_001284854.1 IG_like 39..133 CDD:214653
IG_like 144..226 CDD:214653
IGc2 152..209 CDD:197706
I-set 230..319 CDD:254352 23/110 (21%)
IGc2 243..309 CDD:197706 20/92 (22%)
IG_like 330..424 CDD:214653 23/87 (26%)
IGc2 339..412 CDD:197706 20/72 (28%)
Ig 447..518 CDD:143165
fn3 534..611 CDD:278470
FN3 640..735 CDD:238020
dpr5NP_650080.3 V-set 95..191 CDD:284989 20/96 (21%)
IG_like 98..179 CDD:214653 20/81 (25%)
IG_like 206..278 CDD:214653 22/81 (27%)
Ig 211..278 CDD:143165 21/73 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.