DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fas2 and ImpL2

DIOPT Version :9

Sequence 1:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster
Sequence 2:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster


Alignment Length:210 Identity:49/210 - (23%)
Similarity:77/210 - (36%) Gaps:43/210 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 PTNLEAVEGKPFAANCTARGKPVPEISWI---RDATQLNVATADRFQVNPQTGLVTISSVSQDDY 297
            ||.|:..:|......|...|..||.|.|:   ...::|:...:::......:.:|.:.|....|:
  Fly    65 PTKLQQADGATIEIVCEMMGSQVPSIQWVVGHLPRSELDDLDSNQVAEEAPSAIVRVRSSHIIDH 129

  Fly   298 -----GTYTCLAKNRAGVVDQKTKLNVLVRPQIYELYNVTGARTKEIAIT--------------- 342
                 .||||:.:..:..:...|.::.....::.......||:...|..|               
  Fly   130 VLSEARTYTCVGRTGSKTIYASTVVHPPRSSRLTPEKTYPGAQKPRIIYTEKTHLDLMGSNIQLP 194

  Fly   343 CRAKGRPAPAITFRRWGTQE--EYTNGQQDDDPRIILEPNFDEERGESTGTLRISNAERSDDGLY 405
            ||...||...||   |...|  |...|.:.   |::           :.|.|.||..:..|.|.|
  Fly   195 CRVHARPRAEIT---WLNNENKEIVQGHRH---RVL-----------ANGDLLISEIKWEDMGNY 242

  Fly   406 QCIARN-KGADAYKT 419
            :||||| .|.|...|
  Fly   243 KCIARNVVGKDTADT 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fas2NP_001284854.1 IG_like 39..133 CDD:214653
IG_like 144..226 CDD:214653
IGc2 152..209 CDD:197706
I-set 230..319 CDD:254352 19/90 (21%)
IGc2 243..309 CDD:197706 15/73 (21%)
IG_like 330..424 CDD:214653 30/108 (28%)
IGc2 339..412 CDD:197706 25/90 (28%)
Ig 447..518 CDD:143165
fn3 534..611 CDD:278470
FN3 640..735 CDD:238020
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 23/80 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.