DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fas2 and dpr20

DIOPT Version :9

Sequence 1:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster
Sequence 2:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster


Alignment Length:190 Identity:39/190 - (20%)
Similarity:74/190 - (38%) Gaps:44/190 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 GQDYVVMCEVKADPNPTIDWLR---------NGDPI--------RTTNDK-YVVQTN-----GLL 193
            |....:.|.:....:.|:.|:|         ||:.:        ..|.|| |.::..     .|.
  Fly   284 GSSIHLNCRISLLQDKTVSWVRHNTQDEGKDNGNALDLLTVGMHTYTGDKRYKMEFQYPNNWRLK 348

  Fly   194 IRNVQESDEGIYTCRAAVIETGELLERTIRVEVFIQ-PEIISLPTNLEAVEGKPF------AANC 251
            |.||::.||.||.|:   |.|..  .|.|::.:.:. |:::.:....:.::.|.:      ..:|
  Fly   349 ITNVKKDDEAIYECQ---ISTHP--PRVIQINLHV
NAPKVMIVDEVGDPLQEKYYEIDSTLQLSC 408

  Fly   252 TARGKPVPE--ISWIR-------DATQLNVATADRFQVNPQTGLVTISSVSQDDYGTYTC 302
            ..|...:..  :.|..       |.|:..|:.......:.....::|:.:|:.|.|.|||
  Fly   409 VVRNVAMTSSVVFWKHMDNILNYDVTRGGVSVKTELMEDGANSTLSIAKISKTDSGNYTC 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fas2NP_001284854.1 IG_like 39..133 CDD:214653
IG_like 144..226 CDD:214653 24/96 (25%)
IGc2 152..209 CDD:197706 20/79 (25%)
I-set 230..319 CDD:254352 15/88 (17%)
IGc2 243..309 CDD:197706 14/75 (19%)
IG_like 330..424 CDD:214653
IGc2 339..412 CDD:197706
Ig 447..518 CDD:143165
fn3 534..611 CDD:278470
FN3 640..735 CDD:238020
dpr20NP_612066.1 IG_like 278..365 CDD:214653 20/83 (24%)
Ig 279..378 CDD:299845 24/98 (24%)
Ig 400..471 CDD:299845 13/69 (19%)
IG_like 402..480 CDD:214653 13/67 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.