DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fas2 and wrapper

DIOPT Version :9

Sequence 1:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster
Sequence 2:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster


Alignment Length:458 Identity:103/458 - (22%)
Similarity:180/458 - (39%) Gaps:83/458 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 SLPTNLEAVEGKPFAANCTARGKPVPEISWIRDATQL------NVATADRFQVNPQTGLVTISSV 292
            |:||.::..|.......||. ..|...:.|.||...|      .:...||..:.| .|.:.:::|
  Fly    39 SIPTTVKTYENDTVQLPCTL-NTPFRYVRWHRDDVALVDSRHPELPPPDRIMLWP-NGSLQVANV 101

  Fly   293 SQDDYGTYTCLAKNRAGVVDQKTKLNVLVRPQI-YELYNVTGARTKEI-AITCRAKGRPAPAITF 355
            ...|.|.|.|...:.:|.|.|:..:.|.:.||: .|..::|..|...| .:.|.|:|.|.|.||:
  Fly   102 QSSDTGDYYCEMNSDSGHVVQQHAIEVQLAPQVLIEPSDLTEQRIGAIFEVVCEAQGVPQPVITW 166

  Fly   356 RRWGTQEEYTNGQQDDDPRIILEPNFDEERGESTG---TLRISNAERSDDGLYQCIARN-KGADA 416
            |        .||.       :::|.      .:||   :|.:....|:..||.:|:|.| .|..|
  Fly   167 R--------LNGN-------VIQPQ------SNTGNRQSLILEIKSRNQAGLIECVASNGVGEPA 210

  Fly   417 YKTGHITVEFAPDFSHMKELPPVFSWEQRKANLSCLAMGIPNATIEWHWNGRKI---------KD 472
            ....::.|.|:|:.|..:  |.|::....:|:|.|:....|.||::|..:|..:         :.
  Fly   211 VANVYLHVLFSPEVSIPQ--PVVYTKLGSRAHLECIVEAAPAATVKWFHHGLPVALGAHSTTHES 273

  Fly   473 LYDTNLKI--VGTGPRSDLIVHPVTRQYYSGYKCIATNIHGTAEHDMQLKEARVPDFVSEAKPSQ 535
            ...||..:  .....|..|:|..|.......|:|.|:|........::|....:| .:.:..|..
  Fly   274 ELQTNRSVDHYVNAVRHMLVVKSVRNADMGQYECRASNQISVKSGSVELTGRPMP-CLFKINPGT 337

  Fly   536 LTATTMTFDIRGPSTELGLPILAYSVQYKEALNPDWSTAYNRSWSP-------------DSPYIV 587
            .::|:   .:....||..|||:.:.:::::..:.:.:.....:|:.             .:.|.:
  Fly   338 QSSTS---HVLVWQTESLLPIMEFKLKFRQIPSNNVTRQVRTNWTELTIPAQATNGLIYITTYTL 399

  Fly   588 EGLRPQTEYSFRFAARNQVGLGNWGVNQ---------QQSTPRRSAPEE------PKPLHNPVQH 637
            .||:|.:.|.....|||..|   |..|.         :...|..|...|      .:..||.:..
  Fly   400 HGLQPASLYEVSVLARNSFG---WSDNSKIVRFATGGEVELPNYSTESELQDDFTEEDFHNEITQ 461

  Fly   638 DKE 640
            ..|
  Fly   462 RSE 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fas2NP_001284854.1 IG_like 39..133 CDD:214653
IG_like 144..226 CDD:214653
IGc2 152..209 CDD:197706
I-set 230..319 CDD:254352 23/90 (26%)
IGc2 243..309 CDD:197706 17/71 (24%)
IG_like 330..424 CDD:214653 25/98 (26%)
IGc2 339..412 CDD:197706 21/77 (27%)
Ig 447..518 CDD:143165 18/81 (22%)
fn3 534..611 CDD:278470 16/89 (18%)
FN3 640..735 CDD:238020 1/1 (100%)
wrapperNP_477404.1 Ig 41..124 CDD:299845 22/84 (26%)
IG_like 41..118 CDD:214653 19/78 (24%)
IG_like 145..218 CDD:214653 24/93 (26%)
Ig 147..219 CDD:299845 23/92 (25%)
I-set 224..323 CDD:254352 21/100 (21%)
IGc2 236..314 CDD:197706 18/77 (23%)
FN3 339..431 CDD:238020 18/97 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.