DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fas2 and cntn1a

DIOPT Version :10

Sequence 1:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster
Sequence 2:NP_851300.2 Gene:cntn1a / 353150 ZFINID:ZDB-GENE-030427-1 Length:1032 Species:Danio rerio


Alignment Length:851 Identity:195/851 - (22%)
Similarity:317/851 - (37%) Gaps:227/851 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RAQSPILEIYPKQEVQRKPV----GKPLILTCRPTVPEPSLVADL--QWKDNRNNTILPKPNGRN 85
            |.|...|:::...|  |:.|    |:..:|.|   .|.|....||  :|..|.....:|....| 
Zfish   137 RVQFGYLDMFSTDE--REAVYVKEGQGAVLLC---APPPHFPEDLSFRWMLNEFPEFIPLDQRR- 195

  Fly    86 QPPMYTETLPGESLALMITSLSVEMGGKYYCTASYANTEILEKGV-------------TIKTYVA 137
                :.....|.   |.|:::.....|.|.|   :.::..:.|.|             :::.|.|
Zfish   196 ----FVSQSTGN---LYISTVRSTDSGNYSC---FVSSPAIAKSVFSKFIPLVPIAERSLRKYPA 250

  Fly   138 ITWTNAPENQYPTLGQDYVVMCEVKADPNPTIDWLR-NG--DPIRTTNDKYVVQTNGLLIR--NV 197
            .....:|:: :..|||:..:.|....:|.|.|.|.: :|  .|:|     :.|..:|.|:.  ::
Zfish   251 DIKVKSPDS-WALLGQNITLECFALGNPIPQIRWRKLDGVLPPLR-----HDVSMSGALLHLYSL 309

  Fly   198 QESDEGIYTCRAAVIETGELLERTIRVEVFIQPEIISLPTNLEAVEGKPFAANCTARGKPVPEIS 262
            |..|||:|.|.|...:..:..:..:.||.  .|:.:...::.|...|..:..:|.|.|||.|.:.
Zfish   310 QYEDEGLYECEADNSKGKDWHKTHLYVEG--APDWLEQISSSEVDIGGDYIMSCQASGKPKPHVH 372

  Fly   263 WIRDATQLNVATADRFQVNPQTGLVTISSVSQDDYGTYTCLAKNRAGVVDQKTKLNVLVRPQIYE 327
            ::::..........||           |.:..:|.|.|.|:|:||.||:....:|.|......::
Zfish   373 FLKNGHMYMKGHEVRF-----------SRLGFEDSGMYQCVAENRHGVIHANAELRVFASAPSFQ 426

  Fly   328 LYN-----VTGARTKEIAITCRAKGRPAPAITFRRWGTQEEYTNGQQDDDPRIILEPNFDEERGE 387
             ||     :.|||...:...||.:..|.|.||:.: ||:..:.:.:..    |.|:         
Zfish   427 -YNPVKPKLLGARNGRVVFECRPRAAPRPNITWSK-GTELLHNSSRIS----IWLD--------- 476

  Fly   388 STGTLRISNAERSDDGLYQCIARNKGADAYKTGHITVEFAPDFSHMKELPPVFSWEQRKANLSCL 452
              |:|.:.|..:||:|.|.|.|.|....|..||.:::..|...:.......|...|.  |.:.|:
Zfish   477 --GSLELLNISKSDEGKYTCFAENDRGRANSTGSLSITDATKITLAPSNADVSVGED--ARMECV 537

  Fly   453 AMGIP--NATIEWHWNGRKI---KDLYDTNLKI---VGTGPRSDLIVHPVTRQYYSG-YKCIA-T 507
            |...|  :.|..|..:|..|   :|......|:   .||.....||.|  |:..::| |.|.| |
Zfish   538 ASHDPGLDLTFIWSLDGHTIDLQRDAQHYQRKMDSASGTSSSELLITH--TQLRHAGRYSCTAQT 600

  Fly   508 NI-HGTAEHDMQLKEARVPDFVSEAKPSQLTATTMTFD----IRGPSTELGLPILAYSVQYKE-A 566
            .: :.||..::.::....|       |..:....:|.|    :....|:...||..|:||.:| |
Zfish   601 PVDNTTASAELVVRGPPGP-------PGGVRVDEVTSDSVRVLWSHGTDNLSPISRYTVQLRESA 658

  Fly   567 LNPDWSTAYNRSWSPDSPYIVEG---------LRPQTEYSFRFAARNQVGLGNWGVNQQQSTPRR 622
            ...||..|      ..||..|||         |.|.|||.||..|.|.:|.|.......::|.|.
Zfish   659 AQQDWRDA------ATSPVNVEGNAEMATVVNLLPWTEYEFRVIATNTLGTGPPSEPSPKTTTRE 717

  Fly   623 SAP--------------EEPKPLHNPVQ-----------------HDKEEPVVVS---------- 646
            :.|              .|......|||                 |:..|.:.|:          
Zfish   718 ARPIVAPSDIGGGGGTSRELTITWTPVQSQYYYGSNFGYIIAFKPHNDPEWLRVTVTDPEVQKYV 782

  Fly   647 ------PYSDHFELRWGVPADNGE----------------------------------------- 664
                  |.|..||::.......||                                         
Zfish   783 HKDPKIPPSTRFEVKMKAFNSQGEGPFSNSAFIYSAQDVPAEAPIITEARALSATEAIVIWVPVQ 847

  Fly   665 --PIDRYQIKYCPGVKISGTWTE-LENSCNTVEVMETTSFEMTQLVG---NTYYRIELKAHNAIG 723
              .::|||::|         |.| :||..:...|:.::....|:|..   :::|.:|::|.|..|
Zfish   848 LPTVERYQVRY---------WRESVENEASAQRVLVSSRENHTRLDNMKPDSHYLVEVRACNGAG 903

  Fly   724 YSSPAS 729
            | .|||
Zfish   904 Y-GPAS 908

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fas2NP_001284854.1 Ig 33..121 CDD:472250 21/93 (23%)
Ig strand B 50..54 CDD:409353 1/3 (33%)
Ig strand C 66..70 CDD:409353 2/5 (40%)
Ig strand E 99..103 CDD:409353 1/3 (33%)
Ig strand F 113..118 CDD:409353 2/4 (50%)
Ig 139..209 CDD:472250 21/74 (28%)
Ig strand B 156..159 CDD:409353 0/2 (0%)
Ig strand C 168..172 CDD:409353 1/3 (33%)
Ig strand E 190..194 CDD:409353 1/3 (33%)
Ig strand F 204..209 CDD:409353 2/4 (50%)
IgI_4_MYLK-like 229..319 CDD:409568 22/89 (25%)
Ig strand A 229..232 CDD:409568 1/2 (50%)
Ig strand A' 238..241 CDD:409568 0/2 (0%)
Ig strand B 246..254 CDD:409568 1/7 (14%)
Ig strand C 260..264 CDD:409568 0/3 (0%)
Ig strand C' 267..270 CDD:409568 0/2 (0%)
Ig strand D 277..281 CDD:409568 2/3 (67%)
Ig strand E 285..290 CDD:409568 0/4 (0%)
Ig strand F 298..306 CDD:409568 4/7 (57%)
Ig strand G 309..319 CDD:409568 3/9 (33%)
IG_like 330..424 CDD:214653 27/98 (28%)
Ig strand B 339..343 CDD:409353 0/3 (0%)
Ig strand C 352..356 CDD:409353 2/3 (67%)
Ig strand E 388..394 CDD:409353 2/5 (40%)
Ig strand F 404..409 CDD:409353 2/4 (50%)
Ig 447..515 CDD:409353 23/78 (29%)
Ig strand B 447..451 CDD:409353 1/3 (33%)
Ig strand C 460..464 CDD:409353 1/3 (33%)
Ig strand E 487..491 CDD:409353 1/3 (33%)
Ig strand F 501..506 CDD:409353 3/5 (60%)
FN3 525..619 CDD:238020 31/107 (29%)
FN3 640..735 CDD:238020 28/153 (18%)
cntn1aNP_851300.2 Ig 45..142 CDD:472250 2/4 (50%)
Ig strand B 66..70 CDD:409353
Ig strand C 79..83 CDD:409353
Ig strand E 104..108 CDD:409353
Ig strand F 119..124 CDD:409353
Ig strand G 133..136 CDD:409353
Ig 150..237 CDD:472250 22/102 (22%)
Ig strand B 162..166 CDD:409353 1/3 (33%)
Ig strand C 177..181 CDD:409353 0/3 (0%)
Ig strand E 202..206 CDD:409353 2/6 (33%)
Ig strand F 216..221 CDD:409353 2/7 (29%)
Ig strand G 232..235 CDD:409353 0/2 (0%)
Ig 249..337 CDD:472250 23/93 (25%)
Ig strand B 267..271 CDD:143259 0/3 (0%)
Ig strand C 280..284 CDD:143259 1/3 (33%)
Ig strand E 302..306 CDD:143259 1/3 (33%)
Ig strand F 316..321 CDD:143259 2/4 (50%)
Ig strand G 329..332 CDD:143259 0/2 (0%)
Ig 341..418 CDD:472250 21/87 (24%)
Ig strand B 357..361 CDD:143205 0/3 (0%)
Ig strand C 370..374 CDD:143205 0/3 (0%)
Ig strand E 384..388 CDD:143205 0/3 (0%)
Ig strand F 398..403 CDD:143205 2/4 (50%)
Ig strand G 411..414 CDD:143205 0/2 (0%)
Ig 423..511 CDD:472250 28/104 (27%)
Ig strand B 442..446 CDD:409353 0/3 (0%)
Ig strand C 455..459 CDD:409353 2/3 (67%)
Ig strand E 477..481 CDD:409353 2/3 (67%)
Ig strand F 491..496 CDD:409353 2/4 (50%)
Ig strand G 504..507 CDD:409353 0/2 (0%)
Ig 513..611 CDD:472250 26/101 (26%)
Ig strand B 532..536 CDD:409353 1/3 (33%)
Ig strand C 547..551 CDD:409353 1/3 (33%)
Ig strand E 579..583 CDD:409353 0/3 (0%)
Ig strand F 593..598 CDD:409353 2/4 (50%)
FN3 597..>962 CDD:442628 71/335 (21%)
Ig strand G 606..609 CDD:409353 2/2 (100%)
FN3 627..714 CDD:238020 29/92 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 699..729 6/29 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 907..926 2/2 (100%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.