DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fas2 and LRIT3

DIOPT Version :9

Sequence 1:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster
Sequence 2:NP_940908.3 Gene:LRIT3 / 345193 HGNCID:24783 Length:679 Species:Homo sapiens


Alignment Length:407 Identity:86/407 - (21%)
Similarity:150/407 - (36%) Gaps:99/407 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 IYTCRAAVIETGELLERTIRVEVFIQPEIISLPTNLEAVEGKPFAANCTARGKPVPEISWIR-DA 267
            :.||......||.|.:|. .:|..::|.:::..|.:.:..|......|.|.|.|.|:|:|.| |:
Human   229 LMTCSEPERLTGILFQRA-ELEHCLKPSVMTSATKIMSALGSNVLLRCDATGFPTPQITWTRSDS 292

  Fly   268 TQLNVATADRFQVNPQTG----LVTISSVSQDDYGTYTCLAKNRAGVVDQKTKLNVLVRPQIYEL 328
            :.:|...   .|.:|:.|    :::::.:|..|.|.|.|.|||.||:.:....:.||        
Human   293 SPVNYTV---IQESPEEGVRWSIMSLTGISSKDAGDYKCKAKNLAGMSEAVVTVTVL-------- 346

  Fly   329 YNVTGARTKEIAITCRAKGRPAPAITFRRWGTQEEYTNGQQDDDPRIILEPNFDEERGESTGTLR 393
                |..|           .|.|..|..|.|           |.|...::|.    .|.||.   
Human   347 ----GITT-----------TPIPPDTSERTG-----------DHPEWDVQPG----SGRSTS--- 378

  Fly   394 ISNAERSDDGLYQCIARNKGADAYKTGHITVEFAPDFSHMKELPPVFSWEQRKANLSCLAMGIPN 458
            :|:|..     |...:......::....::......||    |.|..|  ...::.:.|:..|..
Human   379 VSSASS-----YLWSSSFSPTSSFSASTLSPPSTASFS----LSPFSS--STVSSTTTLSTSISA 432

  Fly   459 AT-------IEWHWNGRKIKDLYDTNLKIVGTGPRSDLIVHPVTRQYYSGYKCIATNIHGTAEHD 516
            :|       .:.|..|::       |||:...|.:    :.|.:.........:...:  ..|.:
Human   433 STTMANKRSFQLHQGGKR-------NLKVAKNGSK----LPPASTSKKEELALLDQTM--LTETN 484

  Fly   517 MQLKEARVPDFVSEAKPSQLTATTMTFDIRGPSTELGLPILAYSVQYKE--ALNPDWSTAYNRSW 579
            ..::..||   |||.|.|    .|:|:::...:....:.:|......|:  .||.|         
Human   485 AAIENLRV---VSETKES----VTLTWNMINTTHNSAVTVLYSKYGGKDLLLLNAD--------- 533

  Fly   580 SPDSPYIVEGLRPQTEY 596
            |..:...::||.|..:|
Human   534 SSKNQVTIDGLEPGGQY 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fas2NP_001284854.1 IG_like 39..133 CDD:214653
IG_like 144..226 CDD:214653 6/21 (29%)
IGc2 152..209 CDD:197706 2/4 (50%)
I-set 230..319 CDD:254352 26/93 (28%)
IGc2 243..309 CDD:197706 22/70 (31%)
IG_like 330..424 CDD:214653 16/93 (17%)
IGc2 339..412 CDD:197706 14/72 (19%)
Ig 447..518 CDD:143165 11/77 (14%)
fn3 534..611 CDD:278470 13/65 (20%)
FN3 640..735 CDD:238020
LRIT3NP_940908.3 LRR 1 56..79
leucine-rich repeat 59..82 CDD:275378
LRR_8 61..117 CDD:290566
LRR 2 80..103
leucine-rich repeat 83..106 CDD:275378
LRR 3 104..128
LRR_8 105..165 CDD:290566
LRR_4 105..146 CDD:289563
leucine-rich repeat 107..130 CDD:275378
LRR 4 129..151
LRR_4 131..170 CDD:289563
leucine-rich repeat 131..154 CDD:275378
LRR 5 152..175
leucine-rich repeat 155..168 CDD:275378
Ig 267..345 CDD:299845 24/80 (30%)
IG_like 267..345 CDD:214653 24/80 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 351..375 8/38 (21%)
FN3 486..550 CDD:214495 18/79 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.