DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fas2 and dpr19

DIOPT Version :9

Sequence 1:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster
Sequence 2:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster


Alignment Length:314 Identity:65/314 - (20%)
Similarity:112/314 - (35%) Gaps:65/314 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 NAPENQYPTLGQDYVVM---------CEVKADPNPTIDWLRNGD--------PIRTTNDKYVVQT 189
            |..::|:.|.....|:.         |.||.:...|:.|:|..|        ...:::.:::|:.
  Fly    36 NTLQSQFNTKNNTRVIAQKGGLAILPCVVKVNSPATVSWIRRKDFQLLTVGLSTHSSDKRFLVEH 100

  Fly   190 N------GLLIRNVQESDEGIYTCRAAVIETGELLERTIRVEVFIQPEIISLPTNLEAVEGKPFA 248
            .      .|.|:.|:|.|.|.|.|:.::..|..::.....||..  .||.|.| .|...|.....
  Fly   101 TRHMGHWSLRIKAVREEDRGFYECQLSIYPTQSIVIELKIVEAV--AEISSAP-ELHIDETSTLR 162

  Fly   249 ANC-TARGKPVPE-ISWIRDATQLNVATADRF------QVNPQTGLVTISSVSQDDYGTYTCLAK 305
            ..| ..|....|. :.|..|:..:|..:...|      |.|||:|....||.:.....|....:.
  Fly   163 LECKLKRATENPAFVFWYHDSKMINYDSQGGFVVTSIGQSNPQSGQFYRSSPANKSRATMPMESS 227

  Fly   306 NRAGVVDQKTKLNVLVRPQIYELYNVTGARTKE-----------IAITCRAKGRPAPAITFRRWG 359
            |  ||::.....:..::.....:.:.|...|::           ..:|.:       .:.||..|
  Fly   228 N--GVLNSLLGSSDAIKAPAANVPSSTPYMTQQHQSAYLLNPSVSVLTVK-------QVNFRHAG 283

  Fly   360 TQEEYTNGQQDDDPRIILEPNFDEERGESTGTLRISN-----AERSDDGLYQCI 408
               .||....:..|..|   .....|||.|..::.:|     .|.:.:|.:..|
  Fly   284 ---NYTCAPSNARPASI---TVHVLRGEKTAAMQHANRSILDTETNGNGTFGLI 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fas2NP_001284854.1 IG_like 39..133 CDD:214653
IG_like 144..226 CDD:214653 21/104 (20%)
IGc2 152..209 CDD:197706 17/79 (22%)
I-set 230..319 CDD:254352 24/96 (25%)
IGc2 243..309 CDD:197706 17/73 (23%)
IG_like 330..424 CDD:214653 18/95 (19%)
IGc2 339..412 CDD:197706 16/75 (21%)
Ig 447..518 CDD:143165
fn3 534..611 CDD:278470
FN3 640..735 CDD:238020
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 17/76 (22%)
IGc2 55..125 CDD:197706 15/69 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.