DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fas2 and CG44153

DIOPT Version :9

Sequence 1:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster
Sequence 2:NP_001097136.2 Gene:CG44153 / 34341 FlyBaseID:FBgn0265002 Length:1946 Species:Drosophila melanogaster


Alignment Length:270 Identity:54/270 - (20%)
Similarity:97/270 - (35%) Gaps:56/270 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 ANTEILEKGVTIKTYVAITWTNAPENQYPTLG----------------QDYVVMCEVKADPNPTI 169
            |.|.::|:|......:...:.:..||  |.||                .::::.|..:.......
  Fly   425 AITRMVERGRIGNFTLVANFHHFDEN--PPLGLLELTVNQPQSGVREASEFIISCTAQGSSRMQF 487

  Fly   170 DWLRNGDPIRT---------------TNDKYVVQTNGLLIRNVQESDEGIYTCRAAVIETGELLE 219
            .|.::|..:..               |.|.|   |..|.:......|||:|:|:  |.:.|....
  Fly   488 QWFKDGAVVNASKSTREIWTTVLPPETKDVY---TAILGVTKASRIDEGVYSCK--VTDWGVEQC 547

  Fly   220 RTIRVEVFIQPEIISLPTNLEAVEGKPFAANCTARG----KPVPEI--SWIRDAT--QLNVATAD 276
            |::.:.:...|.:...|.::....|......|.:.|    |...::  ||.|:..  |.:.|||.
  Fly   548 RSLHIHIKSPPRLRVDPASVTLQRGDSLRVRCLSPGNDDIKRYAQLGYSWTRNGVLFQSDAATAM 612

  Fly   277 RFQVNPQTGLVTISSVSQDDYGTYTCLAKNRAGVVDQKTKLNVLVRPQIY-----ELYNV---TG 333
            ...:.|...::.|:::.:.  ..|.||..|....|.:...:||:.|..::     ..|.|   |.
  Fly   613 WEDLYPDGSILKINNIQKS--AEYACLVSNSVRPVSRSVYINVIERNAVHVCPAESTYGVHWPTS 675

  Fly   334 ARTKEIAITC 343
            |....|...|
  Fly   676 APGSPIITDC 685

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fas2NP_001284854.1 IG_like 39..133 CDD:214653 4/11 (36%)
IG_like 144..226 CDD:214653 21/112 (19%)
IGc2 152..209 CDD:197706 14/87 (16%)
I-set 230..319 CDD:254352 20/96 (21%)
IGc2 243..309 CDD:197706 17/73 (23%)
IG_like 330..424 CDD:214653 5/17 (29%)
IGc2 339..412 CDD:197706 2/5 (40%)
Ig 447..518 CDD:143165
fn3 534..611 CDD:278470
FN3 640..735 CDD:238020
CG44153NP_001097136.2 EGF_CA <264..294 CDD:238011
IG_like 467..554 CDD:214653 16/91 (18%)
Ig 474..551 CDD:143165 16/81 (20%)
IG_like 564..653 CDD:214653 19/90 (21%)
Ig 572..642 CDD:299845 17/71 (24%)
HRM 661..718 CDD:280888 6/25 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10075
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.