DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fas2 and ihog

DIOPT Version :10

Sequence 1:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster
Sequence 2:NP_609085.1 Gene:ihog / 33972 FlyBaseID:FBgn0031872 Length:886 Species:Drosophila melanogaster


Alignment Length:901 Identity:177/901 - (19%)
Similarity:298/901 - (33%) Gaps:303/901 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 SPILEIYPKQEVQRKPVGKPLILTCRPTV-PEPSLVADLQWKDNRNNTILPKPNGRNQPPMYTET 93
            ||.:.|....|....|:|..::|.|..:: ||     ..:|....:.:                 
  Fly    50 SPGVRILRAPESLVAPLGDEVVLECETSLQPE-----RFEWSHRSSRS----------------- 92

  Fly    94 LPGESLALMIT-----SLSVEMGGKYYCTASYANTEILEKGVTIKTYVAITW------------- 140
             ||.....:.|     ::|.|        |:.:...:|.:..|:..|..:.|             
  Fly    93 -PGAGFKYLKTGTAKANVSQE--------AAISRLRVLVRPDTLGEYRCVGWFGPLVVTSTIARL 148

  Fly   141 -------TNAPENQYP-----TLGQDYVVMCEVKADPNPTIDW--LRNGDPIRTTNDKYVVQTNG 191
                   .:|.|::.|     :.|...:..|..:...||:..|  .|||..|:..    .:.|||
  Fly   149 ELASTSLVDAQESESPLQWRVSAGNSVLWSCGQQVQSNPSASWSYYRNGVEIKPE----FIGTNG 209

  Fly   192 -LLIRNVQESDEGIYTCRAAVIETGELLERTIRVEVFIQPEIISLPTNLEAVEGKPFAANCTAR- 254
             |.:.||.....|.|:|:|....:||.::....:::.:.||..|...:...:.|:|.:...|.| 
  Fly   210 NLFLSNVSSESSGSYSCQATNPASGERIQLPGSLQLQVTPEQRSESKSPHLLRGQPSSQEITIRE 274

  Fly   255 -----------GKPVPEISWIRDATQLNVATADRFQVNPQTG-LVTISSVSQDDYGTYTCLAKNR 307
                       |.|.|.:.|    :..:|..|.:.:.:...| .:.||:...:|.|||.|...|.
  Fly   275 GSSLLLLCPGVGSPPPTVVW----SSPDVVGAVKNKRSKVFGHALEISNTRVNDAGTYICFQDNG 335

  Fly   308 AGVVDQKTKLNVLVRPQIYELYNVTGARTKEIAITCRAKGRPAPAITFRRWGTQEEYTNGQQDDD 372
                         |||.:                                    |.|.....:..
  Fly   336 -------------VRPAL------------------------------------EHYIKVHVEQP 351

  Fly   373 PRIILEPNFDEERGESTGTLRISNAERSDDGLYQCIARNKGADAYKTGHITVEFAPDFSHMKELP 437
            |:|:..|..|           ::|                                         
  Fly   352 PQIVRPPWAD-----------LTN----------------------------------------- 364

  Fly   438 PVFSWEQRKANLSCLAMGIPNATIEWHWNGRKIKDLYDTNLKIVGTGPRSDLIVHPVTRQYYSGY 502
                 |..:..|.|.|.|:|...|.|..||....|..:..|.      .:.||:|.|.:::....
  Fly   365 -----EGDRLKLECKATGVPTPEIYWLLNGHSSIDDSEAELS------NNFLILHSVLKRHAGYV 418

  Fly   503 KCIATNIHGTAEHD---------MQLKEARVPDFVSEAKPSQLTATTMTFDIRGPS-TEL----- 552
            :|.|.|..|  ||.         .|::|.|........||:|.:.....:....|: |.|     
  Fly   419 QCFARNRLG--EHSAGTLLQVNPKQIQEPRESGGTHRPKPNQGSRQKQMYPPTPPNVTRLSDESV 481

  Fly   553 ----------GLPILAYSVQYK--------EALN-------PDWSTAYNRSWSPDSPYIVEGLRP 592
                      ||||:.:.|||:        :..|       |.|::...:|::..    |..|:|
  Fly   482 MLRWMVPRNDGLPIVIFKVQYRMVGKRKNWQTTNDNIPYGKPKWNSELGKSFTAS----VTDLKP 542

  Fly   593 QTEYSFRFAA---RNQVGLGNWGVNQQQSTPRR-----SAPEEPKPLHNPVQHDKEEPVVVSPYS 649
            |..|.||..|   .|.        |::.:|..:     .|..:|.|:        .|.:.:..||
  Fly   543 QHTYRFRILAVYSNND--------NKESNTSAKFYLQPGAALDPMPV--------PELLEIEEYS 591

  Fly   650 D-HFELRWGVPADNGEP-IDRYQIKYCPGVKISGTWTELENSCNTVEVMETTSFEMTQLVGNTYY 712
            : ...|.|.:.:|..|. |..|...|.|. ..:|.:.:.     |:|.....||::..|...|.|
  Fly   592 ETAVVLHWSLASDADEHLITGYYAYYRPS-SSAGEYFKA-----TIEGAHARSFKIAPLETATMY 650

  Fly   713 RIELKAHNAIGYSSPASIIM------KT-TRGIDVIQVAER--------QVFS-SAAIVGIAIGG 761
            ..:|::.:|...|..:::..      || |.....:|:.:|        :.|: |..:.|...||
  Fly   651 EFKLQSFSAASASEFSALKQGRTQRPKTSTTEEPTLQMGDRDTTTPSHNETFNMSPMLTGTIGGG 715

  Fly   762 VLLLLFVVDLLCCITVHMGVMATMCRKA-KRSPSEIDDEAKLGSLYGWRFPLPYCS 816
            .:|:|.::....|:          ||:. .||.....::.::..|.....||..||
  Fly   716 AVLILLLISTCFCV----------CRRRNSRSRGNNPNKPRMAELRDDFVPLGNCS 761

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fas2NP_001284854.1 Ig 33..121 CDD:472250 15/93 (16%)
Ig strand B 50..54 CDD:409353 1/3 (33%)
Ig strand C 66..70 CDD:409353 0/3 (0%)
Ig strand E 99..103 CDD:409353 0/3 (0%)
Ig strand F 113..118 CDD:409353 0/4 (0%)
Ig 139..209 CDD:472250 22/97 (23%)
Ig strand B 156..159 CDD:409353 0/2 (0%)
Ig strand C 168..172 CDD:409353 1/5 (20%)
Ig strand E 190..194 CDD:409353 3/4 (75%)
Ig strand F 204..209 CDD:409353 2/4 (50%)
IgI_4_MYLK-like 229..319 CDD:409568 22/102 (22%)
Ig strand A 229..232 CDD:409568 1/2 (50%)
Ig strand A' 238..241 CDD:409568 0/2 (0%)
Ig strand B 246..254 CDD:409568 2/7 (29%)
Ig strand C 260..264 CDD:409568 0/3 (0%)
Ig strand C' 267..270 CDD:409568 0/2 (0%)
Ig strand D 277..281 CDD:409568 0/3 (0%)
Ig strand E 285..290 CDD:409568 1/5 (20%)
Ig strand F 298..306 CDD:409568 4/7 (57%)
Ig strand G 309..319 CDD:409568 0/9 (0%)
IG_like 330..424 CDD:214653 7/93 (8%)
Ig strand B 339..343 CDD:409353 0/3 (0%)
Ig strand C 352..356 CDD:409353 0/3 (0%)
Ig strand E 388..394 CDD:409353 0/5 (0%)
Ig strand F 404..409 CDD:409353 0/4 (0%)
Ig 447..515 CDD:409353 19/67 (28%)
Ig strand B 447..451 CDD:409353 1/3 (33%)
Ig strand C 460..464 CDD:409353 1/3 (33%)
Ig strand E 487..491 CDD:409353 1/3 (33%)
Ig strand F 501..506 CDD:409353 1/4 (25%)
FN3 525..619 CDD:238020 27/127 (21%)
FN3 640..735 CDD:238020 24/103 (23%)
ihogNP_609085.1 Ig 266..348 CDD:472250 22/134 (16%)
Ig strand B 278..282 CDD:409353 0/3 (0%)
Ig strand C 291..295 CDD:409353 1/7 (14%)
Ig strand E 313..317 CDD:409353 0/3 (0%)
Ig strand F 327..332 CDD:409353 3/4 (75%)
Ig strand G 341..344 CDD:409353 1/2 (50%)
Ig 352..437 CDD:472250 27/149 (18%)
Ig strand B 369..373 CDD:409353 1/3 (33%)
Ig strand C 382..386 CDD:409353 1/3 (33%)
Ig strand E 404..407 CDD:409353 1/2 (50%)
Ig strand F 417..422 CDD:409353 1/4 (25%)
Ig strand G 430..433 CDD:409353 0/2 (0%)
FN3 467..565 CDD:238020 24/109 (22%)
FN3 582..>655 CDD:238020 19/78 (24%)

Return to query results.
Submit another query.