DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fas2 and DIP-iota

DIOPT Version :9

Sequence 1:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster
Sequence 2:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster


Alignment Length:296 Identity:76/296 - (25%)
Similarity:126/296 - (42%) Gaps:54/296 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 NQYPTLGQDYVVMCEVKADPNPTIDWLRNGDPIRTTNDKYVVQTN-------------GLLIRNV 197
            |....:|:|.::.|.|....:..:.|||.......:...:|:..|             .|.||:|
  Fly    39 NSTVPVGRDALLTCVVHDLVSFKVAWLRVDTQTILSIQNHVITKNHRISISHTEHRIWQLKIRDV 103

  Fly   198 QESDEGIYTCRAAVIETGELLERTIRVEVFIQPEIISLPTNLEAVE--GKPFAANCTARGKPVPE 260
            ||||.|.|.|:   |.|..:..:...::|.:.|:|:...|:.:.|.  |:.....|:|.|.|:|.
  Fly   104 QESDRGWYMCQ---INTDPMKSQMGYLDVVVPPDIVDYQTSQDVVRSTGQNVTLTCSATGVPMPT 165

  Fly   261 ISWIR-DATQLNVA-TADR--FQVNPQTGLVTISSVSQDDYGTYTCLAKNRAGV---VDQKTKLN 318
            |:|.| :||.:.:: ..||  |.|..|.  :|:..|.:...|.|.|:|.|  ||   |.::..|.
  Fly   166 ITWRREEATPILISDDGDREVFSVEGQN--LTLWQVQRSHMGAYLCIASN--GVPPTVSKRVMLV 226

  Fly   319 VLVRPQIYELYNV--TGARTKEIAITCRAKGRPAPAITFRRWGTQEE------YTNGQQDDDPRI 375
            |...|.|:..|:.  .|...| :.:.|..:.:|| ::.|  |....:      |.:...|...||
  Fly   227 VNFAPTIWTRYDTIYVGLGQK-LTLECITESQPA-SVNF--WLRDSQLLQGGSYESVSVDHVFRI 287

  Fly   376 ILEPNFDEERGESTGTLRISNAERSDDGLYQCIARN 411
            ::.             :.:....:.|.|.|.|.|:|
  Fly   288 VMR-------------ITLRPITKRDFGEYICRAKN 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fas2NP_001284854.1 IG_like 39..133 CDD:214653
IG_like 144..226 CDD:214653 23/92 (25%)
IGc2 152..209 CDD:197706 20/69 (29%)
I-set 230..319 CDD:254352 31/97 (32%)
IGc2 243..309 CDD:197706 23/71 (32%)
IG_like 330..424 CDD:214653 17/90 (19%)
IGc2 339..412 CDD:197706 15/79 (19%)
Ig 447..518 CDD:143165
fn3 534..611 CDD:278470
FN3 640..735 CDD:238020
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 23/88 (26%)
Ig 39..122 CDD:299845 23/85 (27%)
Ig 132..213 CDD:299845 26/82 (32%)
IG_like 141..227 CDD:214653 28/89 (31%)
IG_like 239..322 CDD:214653 17/89 (19%)
IGc2 245..313 CDD:197706 16/83 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.